InnateDB InnateDB chiba-2012-1 Tumor-infiltrating DCs suppress nucleic acid-mediated innate immune responses through interactions between the receptor TIM-3 and the alarmin HMGB1. in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined Chiba S., Baghdadi M., Akiba H., Yoshiyama H., Kinoshita I., Dosaka-Akita H., Fujioka Y., Ohba Y., Gorman J.V., Colgan J.D., Hirashima M., Uede T., Takaoka A., Yagita H., Jinushi M. TIM-3 species information inferred from amino acid mapping, HMGB1 from ref. 50, species of RAGE confirmed via correspondence jinushi@igm.hokudai.ac.jp Nat. Immunol. (1529-2908) 2012 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity chiba-2012-2 Tumor-infiltrating DCs suppress nucleic acid-mediated innate immune responses through interactions between the receptor TIM-3 and the alarmin HMGB1. mouse-bmdc Mus musculus bone marrow-derived dendritic cells bmdm-1 bone marrow-derived macrophage confocal microscopy confocal microscopy immunostaining immunostaining Chiba S., Baghdadi M., Akiba H., Yoshiyama H., Kinoshita I., Dosaka-Akita H., Fujioka Y., Ohba Y., Gorman J.V., Colgan J.D., Hirashima M., Uede T., Takaoka A., Yagita H., Jinushi M. TIM-3 species information inferred from amino acid mapping, HMGB1 from ref. 50, species of RAGE confirmed via correspondence jinushi@igm.hokudai.ac.jp Nat. Immunol. (1529-2908) 2012 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity chiba-2012-3 Tumor-infiltrating DCs suppress nucleic acid-mediated innate immune responses through interactions between the receptor TIM-3 and the alarmin HMGB1. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chiba S., Baghdadi M., Akiba H., Yoshiyama H., Kinoshita I., Dosaka-Akita H., Fujioka Y., Ohba Y., Gorman J.V., Colgan J.D., Hirashima M., Uede T., Takaoka A., Yagita H., Jinushi M. TIM-3 species information inferred from amino acid mapping, HMGB1 from ref. 50, species of RAGE confirmed via correspondence jinushi@igm.hokudai.ac.jp Nat. Immunol. (1529-2908) 2012 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity rage_mouse Advanced glycosylation end product-specific receptor Ager Rage Receptor for advanced glycosylation end products protein protein mouse Mus musculus Mouse MPAGTAARAWVLVLALWGAVAGGQNITARIGEPLVLSCKGAPKKPPQQLEWKLNTGRTEAWKVLSPQGGPWDSVARILPNGSLLLPATGIVDEGTFRCRATNRRGKEVKSNYRVRVYQIPGKPEIVDPASELTASVPNKVGTCVSEGSYPAGTLSWHLDGKLLIPDGKETLVKEETRRHPETGLFTLRSELTVIPTQGGTHPTFSCSFSLGLPRRRPLNTAPIQLRVREPGPPEGIQLLVEPEGGIVAPGGTVTLTCAISAQPPPQVHWIKDGAPLPLAPSPVLLLPEVGHEDEGTYSCVATHPSHGPQESPPVSIRVTETGDEGPAEGSVGESGLGTLALALGILGGLGVVALLVGAILWRKRQPRREERKAPESQEDEEERAELNQSEEAEMPENGAGGP hmgb1_mouse High mobility group protein B1 Hmgb1 Hmg-1 Hmg1 High mobility group protein 1 protein protein mouse Mus musculus Mouse MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE havr2_mouse Hepatitis A virus cellular receptor 2 homolog Havcr2 Tim3 Timd3 T-cell immunoglobulin and mucin domain-containing protein 3 T-cell membrane protein 3 T-cell immunoglobulin mucin receptor 3 protein protein mouse Mus musculus Mouse MFSGLTLNCVLLLLQLLLARSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIRTAIHIGVGVSAGLTLALIIGVLILKWYSCKKKKLSSLSLITLANLPPGGLANAGAVRIRSEENIYTIEENVYEVENSNEYYCYVNSQQPS ager-hmgb1 1386429 n/a 1386432 unspecified role unspecified role prey prey region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1386433 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Fig. 6A hmgb1-havcr2 1386429 n/a 1386433 unspecified role unspecified role bait bait P63158:p.Asp62Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1386434 unspecified role unspecified role prey prey region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Fig. 6A, 6B, 6D, S5A. havcr2-hmgb1 1386429 n/a 1386434 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1386433 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind range range range range false direct interaction direct interaction false false false Fig. S5D. havcr2-hmgb1-1 1386430 n/a 1386433 unspecified role unspecified role neutral component neutral component n/a 1386434 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 6E, 7D EEA1 used as an endosomal marker havcr2-hmgb1-2 1386431 n/a 1386433 unspecified role unspecified role prey prey n/a 1386434 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 6F