UniProt UniProt http://www.uniprot.org botros-2012-1 Crystal structure and functional mapping of human ASMT, the last enzyme of the melatonin synthesis pathway. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Botros H.G., Legrand P., Pagan C., Bondet V., Weber P., Ben-Abdallah M., Lemière N., Huguet G., Bellalou J., Maronde E., Beguin P., Haouz A., Shepard W., Bourgeron T. william.shepard@synchrotron-soleil.fr J. Pineal Res. (0742-3098) 2012 Only protein-protein interactions imex curation botros-2012-2 Crystal structure and functional mapping of human ASMT, the last enzyme of the melatonin synthesis pathway. human-pineal_gland Human pineal gland pineal gland pineal gland molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Botros H.G., Legrand P., Pagan C., Bondet V., Weber P., Ben-Abdallah M., Lemière N., Huguet G., Bellalou J., Maronde E., Beguin P., Haouz A., Shepard W., Bourgeron T. william.shepard@synchrotron-soleil.fr J. Pineal Res. (0742-3098) 2012 Only protein-protein interactions imex curation botros-2012-3 Crystal structure and functional mapping of human ASMT, the last enzyme of the melatonin synthesis pathway. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Botros H.G., Legrand P., Pagan C., Bondet V., Weber P., Ben-Abdallah M., Lemière N., Huguet G., Bellalou J., Maronde E., Beguin P., Haouz A., Shepard W., Bourgeron T. Fig 2b. william.shepard@synchrotron-soleil.fr J. Pineal Res. (0742-3098) 2012 Only protein-protein interactions imex curation asmt_human Acetylserotonin O-methyltransferase ASMT Hydroxyindole O-methyltransferase protein protein human Homo sapiens Human MGSSEDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHGTELLLDICVSLKLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWGHLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRSVLTAFDLSVFPLMCDLGGGAGALAKECMSLYPGCKITVFDIPEVVWTAKQHFSFQEEEQIDFQEGDFFKDPLPEADLYILARVLHDWADGKCSHLLERIYHTCKPGGGILVIESLLDEDRRGPLLTQLYSLNMLVQTEGQERTPTHYHMLLSSAGFRDFQFKKTGAIYDAILARK asmt-1 1362177 n/a 1362180 unspecified role unspecified role neutral component neutral component leita Leishmania tarentolae Sauroleishmania tarentolae Stoichiometry: 2.0 direct interaction direct interaction false false false R-Value: 0.177 (obs.), R-Free: 0.204 for 4A6D, R-Value: 0.165 (obs.), R-Free: 0.212 for 4A6E 2.40 A for 4A6D 2.70 A for 4A6E Fig 1. asmt-asmt-1 1362178 n/a 1362180 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 physical association physical association false false false Fig 2 c asmt-asmt-2 1362179 n/a 1362180 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 physical association physical association false false false Fig 2 b