IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lin-2012c-2 Crystal structure of elongator subcomplex Elp4-6. in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Lin Z., Zhao W., Diao W., Xie X., Wang Z., Zhang J., Shen Y., Long J. yuequan74@yahoo.com, jflong@nankai.edu.cn, jiafu.lab@gmail.com J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation lin-2012c-4 Crystal structure of elongator subcomplex Elp4-6. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lin Z., Zhao W., Diao W., Xie X., Wang Z., Zhang J., Shen Y., Long J. yuequan74@yahoo.com, jflong@nankai.edu.cn, jiafu.lab@gmail.com J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation lin-2012c-1 Crystal structure of elongator subcomplex Elp4-6. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lin Z., Zhao W., Diao W., Xie X., Wang Z., Zhang J., Shen Y., Long J. yuequan74@yahoo.com, jflong@nankai.edu.cn, jiafu.lab@gmail.com J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation lin-2012c-3 Crystal structure of elongator subcomplex Elp4-6. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Lin Z., Zhao W., Diao W., Xie X., Wang Z., Zhang J., Shen Y., Long J. yuequan74@yahoo.com, jflong@nankai.edu.cn, jiafu.lab@gmail.com J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation lin-2012c-5 Crystal structure of elongator subcomplex Elp4-6. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lin Z., Zhao W., Diao W., Xie X., Wang Z., Zhang J., Shen Y., Long J. yuequan74@yahoo.com, jflong@nankai.edu.cn, jiafu.lab@gmail.com J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation elp5_yeast Elongator complex protein 5 YHR187W IKI1 ELP5 HAP2 TOT5 Gamma-toxin target 5 Protein IKI1 HAT-associated protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MASSSHNPVILLKRILSLTESSPFILCLDSIAQTSYKLIQEFVHQSKSKGNEYPIVYISFETVNKPSYCTQFIDATQMDFVHLVKQIISYLPAATATQAKKHMVIIDSLNYISTEYITRFLSEIASPHCTMVATYHKDIKDENRTVIPDWNNNYPDKLTLLQFMATTIVDIDVVLTGTLDTEEVSELLNEFRIPRGLNNDIFQLRLVNKRKSGRSLEYDFIVNSNTHEYELLSTTKQEEESSSNGLETPEMLQGLTTFNLGTSNKQKLAKDQVALPFLEAQSFGQGGAIVYEYEKDDDYDEEDPYEDPF DFD93D7BA583E2F5 elp6_yeast Elongator complex protein 6 YMR312W YM9924.04 ELP6 HAP3 TOT6 Gamma-toxin target 6 HAT-associated protein 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGSVQRQDLVLFSDQSVLPAHFFQDSNSHNLFFITHQSCTQPLWMINALVETHVLGSPSSLNESSSSMLPSSTRSHAVLASFIHEQNYFTNSLNKLKIPSNNYNVLDFLSDFIVNNIHNKPRDKILSDVLAKFSAAIQNNPTDTIVIIEQPELLLSLVSGLTCSELNNKFITPLLRQCKVLIIVSNSDIFNIDEYDASVHSSNLQNFYKSSFIKSMINLNLNPLKTGFAKDVTGSLHVCRGGAPIATSNTSLHVVENEYLYLNEKESTKLFYR 1A5062465AF67F47 elp4_yeast Elongator complex protein 4 ELP4 Gamma-toxin target 7 HAT-associated protein 1 YPL101W HAP1 TOT7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFRKRGEILNDRGSGLRGPLLRGPPRTSSTPLRTGNRRAPGNVPLSDTTARLKKLNIADESKTKMGLDSSHVGVRPSPATSQPTTSTGSADLDSILGHMGLPLGNSVLVEEQSTTEFHSILGKLFAAQGIVHNRISDSSADKTRNGDTHVIVLSLNQMFAKELPGIYKGSRKQMKKNLISEEESKVTVQNLNETQRSTPSRYKDLKIAWKYKLADEKRLGSPDRDDIQQNSEYKDYNHQFDITTRLMPAPIASELTFIAPTQPVSTILSQIEQTIKRNDKKLIRIVIPSLLHPAMYPPKMFESSEIIGLMHGVRSLVKKYYERVVLFASISIDIITPPLLVLLRNMFDSVINLEPFNQEMTEFLERVYKSQPGKIQHGLVHILKLPVFTDRGEMRVLKSEWAFKNGRKKFEIEQWGIPVDDAEGSAASEQSHSHSHSDEISHNIPAKKTKISLDY 276F0D1538EAA8FA h3_yeast Histone H3 SIN2 YNL031C N2749 HHT1 YBR010W YBR0201 HHT2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS A6115FEB480AC67A elp4-elp6-1 1374611 n/a 1374616 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobd Escherichia coli (strain B / BL21-DE3) Stoichiometry: 2.0 n/a 1374617 unspecified role unspecified role neutral component neutral component ecobd Escherichia coli (strain B / BL21-DE3) Stoichiometry: 2.0 n/a 1374618 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobd Escherichia coli (strain B / BL21-DE3) Stoichiometry: 2.0 physical association physical association false false false Fig. 3a, Fig. 3b, Suppl. Fig. 3 elp4-elp6-3 1374611 n/a 1374617 unspecified role unspecified role neutral component neutral component ecobd Escherichia coli (strain B / BL21-DE3) Stoichiometry: 1.0 n/a 1374618 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q02884:p.[His293Ala;Phe302Ala] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecobd Escherichia coli (strain B / BL21-DE3) Stoichiometry: 1.0 n/a 1374616 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobd Escherichia coli (strain B / BL21-DE3) Stoichiometry: 1.0 physical association physical association false false false Fig. 3a elp6-elp4 1374612 n/a 1374618 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1374616 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1374617 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1374617 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 4 elp6-elp4-1 1374612 n/a 1374618 unspecified role unspecified role prey prey Q02884:p.[His293Ala;Phe302Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. n/a 1374616 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. n/a 1374617 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association false false false Fig. 4 Less Myc-Elp6 co-precipitates with GFP-Elp6 when Elp4 is mutated (his293ala-phe302ala mutant), indicating that this mutation disrupts dimerization of the Elp4-Elp5-Elp6 heterotrimer. elp4-elp6 1374613 n/a 1374616 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobd Escherichia coli (strain B / BL21-DE3) Stoichiometry: 2.0 n/a 1374618 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobd Escherichia coli (strain B / BL21-DE3) Stoichiometry: 2.0 n/a 1374617 unspecified role unspecified role neutral component neutral component ecobd Escherichia coli (strain B / BL21-DE3) Stoichiometry: 2.0 physical association physical association false false false Fig. 1b, Fig. 3c, Fig. 3d, Suppl. Table S1 2.61A working 17.4%, free 22.4% elp4-elp6-2 1374614 n/a 1374617 unspecified role unspecified role neutral component neutral component ecobd Escherichia coli (strain B / BL21-DE3) Stoichiometry: 1.0 n/a 1374616 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobd Escherichia coli (strain B / BL21-DE3) Stoichiometry: 1.0 n/a 1374618 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobd Escherichia coli (strain B / BL21-DE3) Stoichiometry: 1.0 physical association physical association false false false Suppl. Fig. 1c, Suppl. Fig. 1d hht1-elp4-1 1374615 n/a 1374618 unspecified role unspecified role prey prey Q02884:p.[His293Ala;Phe302Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. n/a 1374616 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. n/a 1374617 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. n/a 1374619 unspecified role unspecified role bait bait n-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag certain certain sequence position certain certain certain sequence position certain false ecobd Escherichia coli (strain B / BL21-DE3) association association false false false Fig. 5