UniProt UniProt http://www.uniprot.org mart_nez-2012-1 Leucine zipper domain is required for Kaposi sarcoma-associated herpesvirus (KSHV) K-bZIP protein to interact with histone deacetylase and is important for KSHV replication. human-bcbl_1 Homo sapiens lymphoma cell line bcbl_1 Human BCBL-1 KSHV/HHV8-Infected body-cavity-based lymphoma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Martínez F.P., Tang Q. Viral K8/K-bZIP protein has been mapped to the UniProt HHV-8/Kaposi's sarcoma-associated herpesvirus virus reference strain. ChIP assays fig 5 not included. qtang@psm.edu J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation mart_nez-2012-2 Leucine zipper domain is required for Kaposi sarcoma-associated herpesvirus (KSHV) K-bZIP protein to interact with histone deacetylase and is important for KSHV replication. human-bcbl_1 Homo sapiens lymphoma cell line bcbl_1 Human BCBL-1 KSHV/HHV8-Infected body-cavity-based lymphoma cell line confocal microscopy confocal microscopy immunostaining immunostaining Martínez F.P., Tang Q. Cells have been treated with TPA for 12h or 48h. Viral K8/K-bZIP protein has been mapped to the UniProt HHV-8/Kaposi's sarcoma-associated herpesvirus virus reference strain. ChIP assays fig 5 not included. qtang@psm.edu J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation mart_nez-2012-3 Leucine zipper domain is required for Kaposi sarcoma-associated herpesvirus (KSHV) K-bZIP protein to interact with histone deacetylase and is important for KSHV replication. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Martínez F.P., Tang Q. Viral K8/K-bZIP protein has been mapped to the UniProt HHV-8/Kaposi's sarcoma-associated herpesvirus virus reference strain. ChIP assays fig 5 not included. qtang@psm.edu J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation mart_nez-2012-4 Leucine zipper domain is required for Kaposi sarcoma-associated herpesvirus (KSHV) K-bZIP protein to interact with histone deacetylase and is important for KSHV replication. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Martínez F.P., Tang Q. Viral K8/K-bZIP protein has been mapped to the UniProt HHV-8/Kaposi's sarcoma-associated herpesvirus virus reference strain. ChIP assays fig 5 not included. qtang@psm.edu J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation hdac2_human Histone deacetylase 2 HDAC2 protein protein human Homo sapiens Human MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP kbzip_hhv8p E3 SUMO-protein ligase K-bZIP K8 E3 SUMO-protein transferase K-bZIP protein protein hhv8p Human herpesvirus 8 Kaposi's sarcoma-associated herpesvirus HHV-8 MPRMKDIPTKSSPGTDNSEKDEAVIEEDLSLNGQPFFTDNTDGGENEVSWTSSLLSTYVGCQPPAIPVCETVIDLTAPSQSGAPGDEHLPCSLNAETKFHIPDPSWTLSHTPPRGPHISQQLPTRRSKRRLHRKFEEERLCTKAKQGAGRPVPASVVKVGNITPHYGEELTRGDAVPAAPITPPYPRVQRPAQPTHVLFSPVFVSLKAEVCDQSHSPTRKQGRYGRVSSKAYTRQLQQALEEKDAQLCFLAARLEAHKEQIIFLRDMLMRMCQQPASPTDAPLPPC hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA pml_human Protein PML PML MYL RNF71 TRIM19 Tripartite motif-containing protein 19 RING finger protein 71 Promyelocytic leukemia protein PP8675 E3 SUMO-protein ligase PML RING-type E3 SUMO transferase PML protein protein human Homo sapiens Human MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPEEAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAVSLEVGLQHFLSFLSSMRRPILACYKLWGPGLPNFFRALEDINRLWEFQEAISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRYLSLQTTTLPPAQPAFNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQS hdac1-hdac2-4 1467871 n/a 1467875 unspecified role unspecified role prey prey n/a 1467876 unspecified role unspecified role prey prey n/a 1467877 unspecified role unspecified role bait bait association association false false false 3a hdac2-hdac1-2 1467871 n/a 1467876 unspecified role unspecified role prey prey n/a 1467875 unspecified role unspecified role bait bait n/a 1467877 unspecified role unspecified role prey prey association association false false false 3a k8-hdac1 1467871 n/a 1467876 unspecified role unspecified role bait bait n/a 1467875 unspecified role unspecified role prey prey n/a 1467877 unspecified role unspecified role prey prey association association false false false 3a hdac1-hdac2-5 1467872 n/a 1467876 unspecified role unspecified role neutral component neutral component n/a 1467877 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2c hdac1-hdac2-6 1467872 n/a 1467875 unspecified role unspecified role neutral component neutral component n/a 1467876 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2f at late time of TPA treatment k8-pml 1467872 n/a 1467878 unspecified role unspecified role neutral component neutral component n/a 1467876 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 1i at early time of TPA treatment k8-hdac2 1467873 n/a 1467876 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 1467875 unspecified role unspecified role prey prey cell lysate cell lysate physical association physical association false false false 4A and C A K8/K-bZIP lys158arg mutant form of K-bZIP which cannot be sumoylated also interacts. hdac2-k8 1467873 n/a 1467876 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 1467875 unspecified role unspecified role bait bait cell lysate cell lysate physical association physical association false false false 4A and C A K8/K-bZIP lys158arg mutant form of K-bZIP which cannot be sumoylated also interacts. k8-hdac2-1 1467874 n/a 1467876 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n/a 1467875 unspecified role unspecified role prey prey cell lysate cell lysate physical association physical association false false false 6D Interaction was not seen using transfected viral BACdLZ plasmid with a deleted C-terminal leucine-zipper domain (ccordinates not given). hdac2-k8-1 1467874 n/a 1467875 unspecified role unspecified role bait bait cell lysate cell lysate n/a 1467876 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 6D Interaction was not seen using transfected viral BACdLZ plasmid with a deleted C-terminal leucine-zipper domain (ccordinates not given).