UniProt UniProt http://www.uniprot.org heo-2012-2 Ca2+-dependent GTPase, extra-large G protein 2 (XLG2), promotes activation of DNA-binding protein related to vernalization 1 (RTV1), leading to activation of floral integrator genes and early flowering in Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Heo J.B., Sung S., Assmann S.M. sma3@psu.edu J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation heo-2012-1 Ca2+-dependent GTPase, extra-large G protein 2 (XLG2), promotes activation of DNA-binding protein related to vernalization 1 (RTV1), leading to activation of floral integrator genes and early flowering in Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Heo J.B., Sung S., Assmann S.M. sma3@psu.edu J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation heo-2012-3 Ca2+-dependent GTPase, extra-large G protein 2 (XLG2), promotes activation of DNA-binding protein related to vernalization 1 (RTV1), leading to activation of floral integrator genes and early flowering in Arabidopsis. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Heo J.B., Sung S., Assmann S.M. sma3@psu.edu J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation heo-2012-4 Ca2+-dependent GTPase, extra-large G protein 2 (XLG2), promotes activation of DNA-binding protein related to vernalization 1 (RTV1), leading to activation of floral integrator genes and early flowering in Arabidopsis. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Heo J.B., Sung S., Assmann S.M. sma3@psu.edu J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation xlg2_arath Extra-large guanine nucleotide-binding protein 2 XLG2 Extra-large GTP-binding protein 2 F10M10.160 At4g34390 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAAVIRKLLPFPSPNPKRDNRESDDDDETSSGYRIEYSFASEYKGPLIANVPRALPVEVDQIPTALPVSFSSLRSGISYPVAPLVMTKDTKRPPDSGIEKKNGFVDSAAGSSVVLIGRDVVSGSSSSSSSKRLDVPEEVKSPADFRLSPSSPLSASAREEDHLDDDRVSDVGPRAVRFVEPFQSSECDESSYVSDGESIAATHRAERKGKRGSCYRCQLGNRFTEKEVCIVCDAKYCFNCVRRAMGAMPEGRKCQACIGYRIDESKRASLGKCSRMLKRHLTDSELRQVMNAEITCKANQLPSRLIIVNDKPLSEDELYTLQTCPNPPKKLKPGHYWYDKVAGYWGKIGEKPSQIISPNNSIGGYISEKVSNGDTEIYINGREITKPELTMLKWAGVQCEGKPHFWVDSDGSYREEGQKHPIGNIWSKKRAKIACAVFSLPVPPASSAVEPYDVPLYEQKMLNKLLLIGSEKGGATTIYKQARSLYNVSFSLEDRERIKFIIQTNLYTYLAMVLEAHERFEKEMSNDQSSGNVGDETSAKPGNSINPRLKHFSDWVLKEKEDGNLKIFPPSSRENAQTVADLWRVPAIQATYKRLRDTLPRNAVYFLERILEISRSEYDPSDMDILQAEGLSSMEGLSCVDFSFPSTSQEESLESDYQHDTDMKYQLIRLNPRSLGENWKLLEMFEDADLVIFCVSLTDYAENIEDGEGNIVNKMLATKQLFENMVTHPSLANKRFLLVLTKFDLLEEKIEEVPLRTCEWFEDFNPLISQNQTSRHNPPMAQRAFHYIGYKFKRLYDSILEPVNMRGRSFKPKLFVCQVSLESDTVDNALRYAREILKWHVEETSMFQEMSTTSIEASSSS rem19_arath B3 domain-containing protein REM19 REM19 RTV1 Protein RELATED TO VERNALIZATION 1 Protein REPRODUCTIVE MERISTEM 19 F13F21.8 At1g49480 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQMDSAQNQFNKRARLFEDPELKDAKVIYPSNPESTEPVNKGYGGSTAIQSFFKESKAEETPKVLKKRGRKKKNPNPEEVNSSTPGGDDSENRSKFYESASARKRTVTAEERERAVNAAKTFEPTNPYFRVVLRPSYLYRGCIMYLPSGFAEKYLSGISGFIKLQLGEKQWPVRCLYKAGRAKFSQGWYEFTLENNIGEGDVCVFELLRTRDFVLEVTAFRVNEYV gg1_arath Guanine nucleotide-binding protein subunit gamma 1 GG1 AGG1 Ggamma-subunit 1 Heterotrimeric G protein gamma-subunit 1 MAA21.50 At3g63420 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MREETVVYEQEESVSHGGGKHRILAELARVEQEVAFLEKELKEVENTDIVSTVCEELLSVIEKGPDPLLPLTNGPLNLGWDRWFEGPNGGEGCRCLIL gbb_arath Guanine nucleotide-binding protein subunit beta GB1 T4L20.40 At4g34460 transducin AGB1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSVSELKERHAVATETVNNLRDQLRQRRLQLLDTDVARYSAAQGRTRVSFGATDLVCCRTLQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQSVACGGLDSVCSIFSLSSTADKDGTVPVSRMLTGHRGYVSCCQYVPNEDAHLITSSGDQTCILWDVTTGLKTSVFGGEFQSGHTADVLSVSISGSNPNWFISGSCDSTARLWDTRAASRAVRTFHGHEGDVNTVKFFPDGYRFGTGSDDGTCRLYDIRTGHQLQVYQPHGDGENGPVTSIAFSVSGRLLFAGYASNNTCYVWDTLLGEVVLDLGLQQDSHRNRISCLGLSADGSALCTGSWDSNLKIWAFGGHRRVI xlg2-rtv1 1421989 n/a 1421993 unspecified role unspecified role bait bait c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false C6KIE6:p.Thr476Asn mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1421994 unspecified role unspecified role prey prey physical association physical association false false false Fig. 3A agg1-agb1 1421989 n/a 1421995 unspecified role unspecified role bait bait n/a 1421996 unspecified role unspecified role prey prey physical association physical association false false false Fig. 3A xlg2-rtv1 1421990 n/a 1421993 unspecified role unspecified role bait bait n/a 1421994 unspecified role unspecified role prey prey physical association physical association false false false rtv1-xlg2 1421991 n/a 1421993 unspecified role unspecified role prey prey c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false C6KIE6:p.Thr476Asn mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1421994 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 3B xlg2-rtv1-1 1421992 n/a 1421993 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1421994 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 4