UniProt UniProt http://www.uniprot.org kuroda-2012-2 Parkin interacts with Klokin1 for mitochondrial import and maintenance of membrane potential. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kuroda Y., Sako W., Goto S., Sawada T., Uchida D., Izumi Y., Takahashi T., Kagawa N., Matsumoto M., Matsumoto M., Takahashi R., Kaji R., Mitsui T. Parkinsons - Interactions investigated in the context of Parkinsons disease tmitsui@tokusima.hosp.go.jp Hum. Mol. Genet. (0964-6906) 2012 mimix curation kuroda-2012-3 Parkin interacts with Klokin1 for mitochondrial import and maintenance of membrane potential. mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kuroda Y., Sako W., Goto S., Sawada T., Uchida D., Izumi Y., Takahashi T., Kagawa N., Matsumoto M., Matsumoto M., Takahashi R., Kaji R., Mitsui T. Parkinsons - Interactions investigated in the context of Parkinsons disease tmitsui@tokusima.hosp.go.jp Hum. Mol. Genet. (0964-6906) 2012 mimix curation kuroda-2012-1 Parkin interacts with Klokin1 for mitochondrial import and maintenance of membrane potential. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kuroda Y., Sako W., Goto S., Sawada T., Uchida D., Izumi Y., Takahashi T., Kagawa N., Matsumoto M., Matsumoto M., Takahashi R., Kaji R., Mitsui T. Parkinsons - Interactions investigated in the context of Parkinsons disease tmitsui@tokusima.hosp.go.jp cDNA library of human fetal brain and human skeletal muscle. Hum. Mol. Genet. (0964-6906) 2012 mimix curation kuroda-2012-4 Parkin interacts with Klokin1 for mitochondrial import and maintenance of membrane potential. human-rd Homo sapiens rd rd fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Kuroda Y., Sako W., Goto S., Sawada T., Uchida D., Izumi Y., Takahashi T., Kagawa N., Matsumoto M., Matsumoto M., Takahashi R., Kaji R., Mitsui T. Parkinsons - Interactions investigated in the context of Parkinsons disease tmitsui@tokusima.hosp.go.jp Hum. Mol. Genet. (0964-6906) 2012 mimix curation kuroda-2012-5 Parkin interacts with Klokin1 for mitochondrial import and maintenance of membrane potential. mouse-brain Mus musculus brain brain Brain [cerebrum] fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Kuroda Y., Sako W., Goto S., Sawada T., Uchida D., Izumi Y., Takahashi T., Kagawa N., Matsumoto M., Matsumoto M., Takahashi R., Kaji R., Mitsui T. Parkinsons - Interactions investigated in the context of Parkinsons disease tmitsui@tokusima.hosp.go.jp Hum. Mol. Genet. (0964-6906) 2012 mimix curation kuroda-2012-6 Parkin interacts with Klokin1 for mitochondrial import and maintenance of membrane potential. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Kuroda Y., Sako W., Goto S., Sawada T., Uchida D., Izumi Y., Takahashi T., Kagawa N., Matsumoto M., Matsumoto M., Takahashi R., Kaji R., Mitsui T. Parkinsons - Interactions investigated in the context of Parkinsons disease tmitsui@tokusima.hosp.go.jp Hum. Mol. Genet. (0964-6906) 2012 mimix curation prkn_human E3 ubiquitin-protein ligase parkin PRKN PARK2 Parkin RBR E3 ubiquitin-protein ligase Parkinson juvenile disease protein 2 protein protein human Homo sapiens Human MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV q8iz52-2 Chondroitin sulfate synthase 2 Klokin1 CHPF CSS2 Chondroitin glucuronyltransferase 2 Chondroitin-polymerizing factor Glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase II N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase II N-acetylgalactosaminyltransferase 2 UNQ651/PRO1281 protein protein human Homo sapiens Human MEYTLDLQLEALTPQGGRRPLTRRVQLLRPLSRVEILPVPYVTEASRLTVLLPLAAAERDLAPGFLEAFATAALEPGDAAAALTLLLLYEPRQAQRVAHADVFAPVKAHVAELERRFPGARVPWLSVQTAAPSPLRLMDLLSKKHPLDTLFLLAGPDTVLTPDFLNRCRMHAISGWQAFFPMHFQAFHPAVAPPQGPGPPELGRDTGRFDRQAASEACFYNSDYVAARGRLAAASEQEEELLESLDVYELFLHFSSLHVLRAVEPALLQRYRAQTCSARLSEDLYHRCLQSVLEGLGSRTQLAMLLFEQEQGNST prkn_mouse E3 ubiquitin-protein ligase parkin Prkn Park2 Parkin RBR E3 ubiquitin-protein ligase protein protein mouse Mus musculus Mouse MIVFVRFNSSYGFPVEVDSDTSILQLKEVVAKRQGVPADQLRVIFAGKELPNHLTVQNCDLEQQSIVHIVQRPRRRSHETNASGGDEPQSTSEGSIWESRSLTRVDLSSHTLPVDSVGLAVILDTDSKRDSEAARGPVKPTYNSFFIYCKGPCHKVQPGKLRVQCGTCKQATLTLAQGPSCWDDVLIPNRMSGECQSPDCPGTRAEFFFKCGAHPTSDKDTSVALNLITSNRRSIPCIACTDVRSPVLVFQCNHRHVICLDCFHLYCVTRLNDRQFVHDAQLGYSLPCVAGCPNSLIKELHHFRILGEEQYTRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEQGQRKVTCEGGNGLGCGFVFCRDCKEAYHEGDCDSLLEPSGATSQAYRVDKRAAEQARWEEASKETIKKTTKPCPRCNVPIEKNGGCMHMKCPQPQCKLEWCWNCGCEWNRACMGDHWFDV q6iqx7-2 Chondroitin sulfate synthase 2 Klokin1 Chpf Css2 D1Bwg1363e Chondroitin glucuronyltransferase 2 Chondroitin-polymerizing factor Glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase II N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase II N-acetylgalactosaminyltransferase 2 protein protein mouse Mus musculus Mouse MEYTLDLQLEALTPQGGRWPLTRRVQLLRPLSRVEILPVPYVTEASRLTVLLPLAAAERDLASGFLEAFATAALEPGDAAALTLLLLYEPRQAQRAAHSDVFAPVKAHVAELERRFPGARVPWLSVQTAAPSPLRLMDLLSKKHPLDTLFLLAGPDTVLTPDFLNRCRMHAISGWQAFFPMHFQAFHPAVAPPQGPGPPELGRDTGHFDRQAASEACFYNSDYVAARGRLVAASEQEEELLESLDVYELFLRFSNLHVLRAVEPALLQRYRAQPCSARLSEDLYHRCRQSVLEGLGSRTQLAMLLFEQEQGNST park2-chpf-5 1440991 n/a 1440997 unspecified role unspecified role bait bait n/a 1440998 unspecified role unspecified role prey prey physical association physical association false false false S2c chpf-chpf 1440991 n/a 1440997 unspecified role unspecified role prey prey n/a 1440998 unspecified role unspecified role bait bait physical association physical association false false false S2c chpf-chpf-1 1440992 n/a 1440999 unspecified role unspecified role prey prey n/a 1441000 unspecified role unspecified role bait bait physical association physical association false false false S2e park2-chpf-6 1440992 n/a 1441000 unspecified role unspecified role prey prey n/a 1440999 unspecified role unspecified role bait bait physical association physical association false false false S2d park2-chpf-4 1440993 n/a 1440997 unspecified role unspecified role bait bait n/a 1440998 unspecified role unspecified role prey prey physical association physical association false false false no figure chpf-chpf-2 1440994 n/a 1440998 unspecified role unspecified role neutral component neutral component n/a 1440997 unspecified role unspecified role neutral component neutral component physical association physical association false false false S3a chpf-chpf-3 1440995 n/a 1441000 unspecified role unspecified role neutral component neutral component n/a 1440999 unspecified role unspecified role neutral component neutral component physical association physical association false false false S4b chpf-chpf-4 1440996 n/a 1440997 unspecified role unspecified role neutral component neutral component n/a 1440998 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 3a