UniProt UniProt http://www.uniprot.org patton-2011-1 Cofactor mobility determines reaction outcome in the IMPDH and GMPR (β-α)8 barrel enzymes. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Patton G.C., Stenmark P., Gollapalli D.R., Sevastik R., Kursula P., Flodin S., Schuler H., Swales C.T., Eklund H., Himo F., Nordlund P., Hedstrom L. par.nordlund@ki.se Nat. Chem. Biol. (1552-4450) 2011 imex curation Only protein-protein interactions imp IMP 2'-inosine-5'-monophosphate 5'-IMP 5'-Inosinate 5'-Inosine monophosphate 5'-Inosinic acid hypoxanthosine 5'-monophosphate IMP Inosine 5'-monophosphate Inosine 5'-phosphate Inosine monophosphate inosinic acid Inosinic acid ribosylhypoxanthine monophosphate 5'-inosinic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) GRSZFWQUAKGDAV-KQYNXXCUSA-N nadph NADPH dihydronicotinamide-adenine dinucleotide phosphate NADPH NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE reduced nicotinamide-adenine dinucleotide phosphate TPNH 2'-O-phosphonoadenosine 5'-{3-[1-(3-carbamoyl-1,4-dihydropyridin-1-yl)-1,4-anhydro-D-ribitol-5-yl] dihydrogen diphosphate} small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) ACFIXJIJDZMPPO-NNYOXOHSSA-N gmpr2_human GMP reductase 2 Guanosine 5'-monophosphate oxidoreductase 2 GMPR2 protein protein human Homo sapiens Human MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEAC gmpr2-imp-1 1467769 n/a 1467770 unspecified role unspecified role unspecified role unspecified role Stoichiometry: 8.0 n/a 1467771 unspecified role unspecified role unspecified role unspecified role Stoichiometry: 7.0 n/a 1467772 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 4.0 direct interaction direct interaction false false false suppl. fig 6b 1.70 A R-factor: 0.165, R-free: 0.206 gmpr2-imp-2 1467769 n/a 1467770 unspecified role unspecified role neutral component neutral component Stoichiometry: 8.0 n/a 1467772 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 4.0 direct interaction direct interaction false false false suppl. fig 6 2.15 A R-factor: 0.161, R-free: 0.210