UniProt UniProt http://www.uniprot.org rahajeng-2012-1 MICAL-L1 is a tubular endosomal membrane hub that connects Rab35 and Arf6 with Rab8a. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Rahajeng J., Giridharan S.S., Cai B., Naslavsky N., Caplan S. Rab35 constructs described in supplemental data of PubMed=20159556. Human Rab35 (NM_006861) was obtained from Invitrogen...Rab35 S22N and Q67L were produced by MEGA primer approach and cloned into pEGFP-C1, pcDNA3-Flag or -myc. See also fig 3C. scaplan@unmc.edu,nnaslavsky@unmc.edu Traffic (1398-9219) 2012 mimix curation rahajeng-2012-2 MICAL-L1 is a tubular endosomal membrane hub that connects Rab35 and Arf6 with Rab8a. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Rahajeng J., Giridharan S.S., Cai B., Naslavsky N., Caplan S. Rab35 constructs described in supplemental data of PubMed=20159556. Human Rab35 (NM_006861) was obtained from Invitrogen...Rab35 S22N and Q67L were produced by MEGA primer approach and cloned into pEGFP-C1, pcDNA3-Flag or -myc. See also fig 3C. scaplan@unmc.edu,nnaslavsky@unmc.edu Traffic (1398-9219) 2012 mimix curation rahajeng-2012-3 MICAL-L1 is a tubular endosomal membrane hub that connects Rab35 and Arf6 with Rab8a. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy tag visualisation tag visualisation Rahajeng J., Giridharan S.S., Cai B., Naslavsky N., Caplan S. Rab35 constructs described in supplemental data of PubMed=20159556. Human Rab35 (NM_006861) was obtained from Invitrogen...Rab35 S22N and Q67L were produced by MEGA primer approach and cloned into pEGFP-C1, pcDNA3-Flag or -myc. See also fig 3C. scaplan@unmc.edu,nnaslavsky@unmc.edu Traffic (1398-9219) 2012 mimix curation milk1_human MICAL-like protein 1 MICALL1 KIAA1668 MIRAB13 Molecule interacting with Rab13 protein protein human Homo sapiens Human MAGPRGALLAWCRRQCEGYRGVEIRDLSSSFRDGLAFCAILHRHRPDLLDFDSLSKDNVFENNRLAFEVAEKELGIPALLDPNDMVSMSVPDCLSIMTYVSQYYNHFCSPGQAGVSPPRKGLAPCSPPSVAPTPVEPEDVAQGEELSSGSLSEQGTGQTPSSTCAACQQHVHLVQRYLADGRLYHRHCFRCRRCSSTLLPGAYENGPEEGTFVCAEHCARLGPGTRSGTRPGPFSQPKQQHQQQLAEDAKDVPGGGPSSSAPAGAEADGPKASPEARPQIPTKPRVPGKLQELASPPAGRPTPAPRKASESTTPAPPTPRPRSSLQQENLVEQAGSSSLVNGRLHELPVPKPRGTPKPSEGTPAPRKDPPWITLVQAEPKKKPAPLPPSSSPGPPSQDSRQVENGGTEEVAQPSPTASLESKPYNPFEEEEEDKEEEAPAAPSLATSPALGHPESTPKSLHPWYGITPTSSPKTKKRPAPRAPSASPLALHASRLSHSEPPSATPSPALSVESLSSESASQTAGAELLEPPAVPKSSSEPAVHAPGTPGNPVSLSTNSSLASSGELVEPRVEQMPQASPGLAPRTRGSSGPQPAKPCSGATPTPLLLVGDRSPVPSPGSSSPQLQVKSSCKENPFNRKPSPAASPATKKATKGSKPVRPPAPGHGFPLIKRKVQADQYIPEEDIHGEMDTIERRLDALEHRGVLLEEKLRGGLNEGREDDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEYELRCLLNKPEKDWTEEDRAREKVLMQELVTLIEQRNAIINCLDEDRQREEEEDKMLEAMIKKKEFQREAEPEGKKKGKFKTMKMLKLLGNKRDAKSKSPRDKS rab35_human Ras-related protein Rab-35 Ras-related protein Rab-1C GTP-binding protein RAY RAB35 RAB1C RAY protein protein human Homo sapiens Human MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC arf6_human ADP-ribosylation factor 6 ARF6 protein protein human Homo sapiens Human MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS rab10_human Ras-related protein Rab-10 RAB10 protein protein human Homo sapiens Human MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC rab8a_human Ras-related protein Rab-8A Oncogene c-mel RAB8A MEL RAB8 protein protein human Homo sapiens Human MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL micall1-rab35 1443710 n/a 1443713 unspecified role unspecified role bait bait n/a 1443714 unspecified role unspecified role prey prey physical association physical association false false false fig 4A arf6-micall1 1443710 n/a 1443713 unspecified role unspecified role prey prey n/a 1443715 unspecified role unspecified role bait bait physical association physical association false false false fig 6H rab35-micall1 1443711 n/a 1443713 unspecified role unspecified role prey prey n/a 1443714 unspecified role unspecified role bait bait physical association physical association false false false fig 4C rab10-micall1 1443711 n/a 1443716 unspecified role unspecified role bait bait n/a 1443713 unspecified role unspecified role prey prey physical association physical association false false false fig 4C arf6-rab8a 1443712 n/a 1443715 unspecified role unspecified role neutral component neutral component n/a 1443717 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false fig 5