IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ oldham-2011-1 Crystal structure of the maltose transporter in a pretranslocation intermediate state. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Oldham M.L., Chen J. chenjue@purdue.edu Science (0036-8075) 2011 Only protein-protein interactions imex curation maltose Maltose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) male_ecoli Maltose/maltodextrin-binding periplasmic protein malE MMBP Maltodextrin-binding protein Maltose-binding protein JW3994 b4034 protein protein ecoli Escherichia coli (strain K12) MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK malf_ecoli Maltose/maltodextrin transport system permease protein MalF malF b4033 JW3993 protein protein ecoli Escherichia coli (strain K12) MDVIKKKHWWQSDALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSITADGNWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAIVNLKATRMKFD malk_ecoli Maltose/maltodextrin import ATP-binding protein MalK malK b4035 JW3995 protein protein ecoli Escherichia coli (strain K12) MASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV amp-pnp AMP-PNP small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) malg_ecoli Maltose/maltodextrin transport system permease protein MalG JW3992 b4032 malG protein protein ecoli Escherichia coli (strain K12) MAMVQPKSQKARLFITHLLLLLFIAAIMFPLLMVVAISLRQGNFATGSLIPEQISWDHWKLALGFSVEQADGRITPPPFPVLLWLWNSVKVAGISAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQMFPAVLSLVALYALFDRLGEYIPFIGLNTHGGVIFAYLGGIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVMSALPITIVFLLAQRWLVNGLTAGGVKG male-malfgk2 wt complex 1353879 n/a 1353880 unspecified role unspecified role neutral component neutral component Stoichiometry: 1.0 n/a 1353881 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a 1353882 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a 1353883 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a 1353884 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1353885 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 physical association physical association false false false Fig.s 2c, 3, S1, S2, S4-S6, S8 R = 0.22 Rworking = 0.21, Rfree = 0.25 3.1 A pentamer consisting of 3 monomers (malF, malG, malE) and one dimer (malK2). maltose transporter MalFGK2; maltose transporter; maltose transporter MalFGK2 complex; maltose transporter complex The maltose transporter channels maltose from the periplasmic space into the cytoplasm through an ATP-dependent transmembrane channel. It consists of a transmembrane (TM) heterodimer (malFG) and a cytoplasmic ATPase (malK2). Maltose binds to malE, the maltose binding protein (MBP), which attaches to the malFG dimer. Upon release of the maltose into the TM channel the malK2 dimer acquires ATP whose hydrolysis triggers the release of maltose into the cytoplasm. This crystal contains wild-type malE and the nonhydrolysable ATP analog, AMP-PNP. male-malfgk2 mt co-1 1353879 n/a 1353882 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a 1353883 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a 1353884 unspecified role unspecified role neutral component neutral component n/a 1353880 unspecified role unspecified role neutral component neutral component Stoichiometry: 1.0 n/a 1353881 unspecified role unspecified role neutral component neutral component P0AEX9:p.Ser363Cys mutation mutation certain certain sequence position certain certain certain sequence position certain false P0AEX9:p.Gly95Cys mutation mutation certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a 1353885 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 physical association physical association false false false Fig.s 2b, 3b, S6, S8 R = 0.22 Rworking = 0.21, Rfree = 0.25 3.1 A pentamer consisting of 3 monomers (malF, malG, malE) and one dimer (malK2). maltose transporter MalFGK2; maltose transporter; maltose transporter MalFGK2 complex; maltose transporter complex The maltose transporter channels maltose from the periplasmic space into the cytoplasm through an ATP-dependent transmembrane channel. It consists of a transmembrane (TM) heterodimer (malFG) and a cytoplasmic ATPase (malK2). Maltose binds to malE, the maltose binding protein (MBP), which attaches to the malFG dimer. Upon release of the maltose into the TM channel the malK2 dimer acquires ATP whose hydrolysis triggers the release of maltose into the cytoplasm. This crystal contains malE mutant and the nonhydrolysable ATP analog, AMP-PNP. male-malfgk2 mt co-2 1353879 n/a 1353882 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a 1353883 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a 1353880 unspecified role unspecified role neutral component neutral component Stoichiometry: 1.0 n/a 1353881 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P0AEX9:p.Ser363Cys mutation mutation certain certain sequence position certain certain certain sequence position certain false P0AEX9:p.Gly95Cys mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a 1353885 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 physical association physical association false false false Fig.s 2b, 3a, S1, S2, S4, S5 R = 0.22 Rworking = 0.21, Rfree = 0.25 3.1 A pentamer consisting of 3 monomers (malF, malG, malE) and one dimer (malK2). maltose transporter MalFGK2; maltose transporter; maltose transporter MalFGK2 complex; maltose transporter complex The maltose transporter channels maltose from the periplasmic space into the cytoplasm through an ATP-dependent transmembrane channel. It consists of a transmembrane (TM) heterodimer (malFG) and a cytoplasmic ATPase (malK2). Maltose binds to malE, the maltose binding protein (MBP), which attaches to the malFG dimer. Upon release of the maltose into the TM channel the malK2 dimer acquires ATP whose hydrolysis triggers the release of maltose into the cytoplasm. This crystal contains malE mutant.