UniProt UniProt http://www.uniprot.org wu-2011d-1 Rab13-dependent trafficking of RhoA is required for directional migration and angiogenesis. mouse-heart_endothelium MOUSE ENDOTHELIAL CELLS heart_endothelium HEART ENDOTHELIAL CELLS anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wu C., Agrawal S., Vasanji A., Drazba J., Sarkaria S., Xie J., Welch C.M., Liu M., Anand-Apte B., Horowitz A. horowia@ccf.org J. Biol. Chem. (0021-9258) 2011 mimix curation wu-2011d-2 Rab13-dependent trafficking of RhoA is required for directional migration and angiogenesis. mouse-heart_endothelium MOUSE ENDOTHELIAL CELLS heart_endothelium HEART ENDOTHELIAL CELLS confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Wu C., Agrawal S., Vasanji A., Drazba J., Sarkaria S., Xie J., Welch C.M., Liu M., Anand-Apte B., Horowitz A. horowia@ccf.org J. Biol. Chem. (0021-9258) 2011 mimix curation rab13_mouse Ras-related protein Rab-13 Rab13 protein protein mouse Mus musculus Mouse MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKIRTVDIEGKRIKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRQVQREQAEKLAREHRIRFFETSAKSSVNVDEAFSSLARDILLKTGGRRSGTNSKPSSTGLKTSDKKKNKCLLG Could participate in polarized transport, in the assembly and/or the activity of tight junctions mint grb2_mouse Growth factor receptor-bound protein 2 Grb2 Adapter protein GRB2 SH2/SH3 adapter GRB2 protein protein mouse Mus musculus Mouse MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQMPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV rab13-grb2 1436026 n/a 1436028 unspecified role unspecified role bait bait n/a 1436029 unspecified role unspecified role prey prey physical association physical association false false false 5E grb2-rab13 1436027 n/a 1436028 unspecified role unspecified role neutral component neutral component n/a 1436029 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 5C/D