UniProt UniProt http://www.uniprot.org hammani-2011-1 An Arabidopsis dual-localized pentatricopeptide repeat protein interacts with nuclear proteins involved in gene expression regulation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hammani K., Gobert A., Hleibieh K., Choulier L., Small I., Giegé P. philippe.giege@ibmp-crns.unistra.fr Arabidopsis cDNA library - 6-d-old Arabidopsis seedlings (DualsystemsBiotech) Plant Cell (1040-4651) 2011 Only protein-protein interactions imex curation hammani-2011-2 An Arabidopsis dual-localized pentatricopeptide repeat protein interacts with nuclear proteins involved in gene expression regulation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Hammani K., Gobert A., Hleibieh K., Choulier L., Small I., Giegé P. philippe.giege@ibmp-crns.unistra.fr Arabidopsis cDNA library - 6-d-old Arabidopsis seedlings (DualsystemsBiotech) Plant Cell (1040-4651) 2011 Only protein-protein interactions imex curation hammani-2011-3 An Arabidopsis dual-localized pentatricopeptide repeat protein interacts with nuclear proteins involved in gene expression regulation. allium_epidermis Allium cepa (onion) epidermis A thin surface layer of tissue in higher plants formed by growth of a primary meristem. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Hammani K., Gobert A., Hleibieh K., Choulier L., Small I., Giegé P. philippe.giege@ibmp-crns.unistra.fr Arabidopsis cDNA library - 6-d-old Arabidopsis seedlings (DualsystemsBiotech) Plant Cell (1040-4651) 2011 Only protein-protein interactions imex curation nap1a_arath Nucleosome assembly protein 1;1 NAP1;1 NFA1 Nucleosome/chromatin assembly factor group A1 F20B18.220 At4g26110 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSNDKDSFNVSDLTAALKDEDRAGLVNALKNKLQNLAGQRSDVLENLTPNVRKRVDALRDIQSQHDELEAKFREERAILEAKYQTLYQPLYVKRYEIVNGTTEVELAPEDDTKVDQGEEKTAEEKGVPSFWLTALKNNDVISEEVTERDEGALKYLKDIKWCKIEEPKGFKLEFFFDTNPYFKNTVLTKSYHMIDEDEPLLEKAMGTEIDWYPGKCLTQKILKKKPKKGSKNTKPITKLEDCESFFNFFSPPEVPDEDEDIDEERAEDLQNLMEQDYDIGSTIREKIIPRAVSWFTGEAMEAEDFEIDDDEEDDIDEDEDEEDEEDEEDDDDEDEEESKTKKKPSIGNKKGGRSQIVGEGKQDERPPECKQQ pp438_arath Pentatricopeptide repeat-containing protein PNM1, mitochondrial PNM1 PPR PROTEIN LOCALIZED TO THE NUCLEUS AND MITOCHONDRIA 1 MSL3.8 At5g60960 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPPSLPSLQLRRLLLRSFISSSSVNTLQSQPRIISSKPLFSPLPPSRSSIFSTFPSRFFSSETNAESESLDSNEIALSFSKELTGNPDAESQTISQRFNLSFSHITPNPDLILQTLNLSPEAGRAALGFNEWLDSNSNFSHTDETVSFFVDYFGRRKDFKGMLEIISKYKGIAGGKTLESAIDRLVRAGRPKQVTDFFEKMENDYGLKRDKESLTLVVKKLCEKGHASIAEKMVKNTANEIFPDENICDLLISGWCIAEKLDEATRLAGEMSRGGFEIGTKAYNMMLDCVCKLCRKKDPFKLQPEVEKVLLEMEFRGVPRNTETFNVLINNLCKIRRTEEAMTLFGRMGEWGCQPDAETYLVLIRSLYQAARIGEGDEMIDKMKSAGYGELLNKKEYYGFLKILCGIERLEHAMSVFKSMKANGCKPGIKTYDLLMGKMCANNQLTRANGLYKEAAKKGIAVSPKEYRVDPRFMKKKTKEVDSNVKKRETLPEKTARKKKRLKQINMSFVKKPHNKMRRRM q9fir7_arath MXC17.7 MXC17_7 At5g24680 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSALCPVCNLTLPLSLIQSHVNSHFEDDEINPQIETDHHLALQLASDDHSSDDPSSSSSASSSNNVASLVQLQTKSQFYSVGHGGLICLLRNCLESELKLKSKPLECSTSLLSGFVDHFQSSKEDKGWGCGWKNIQMQCSHLLSHREEAKRVLFGGSNFVPDIPSLQRWLELAWNKGFDVSGALHFDNRICGSKRWIGTTECAALLRSFGLKARIVDFAPEKSKSMYLSVPGSAIAPKVKSYGPMDRYMVKKGGSGKGKAVDSHSSNSSRISKGAVLMEWVWNYFSDNRLSVSSGVHITNKGPLYFQHEGHSRTIVGVQRRLQGTTFTPQYNLLILDPADFTRAIEIALIEKRGWEGYLKRGAHTLKCPEYQMLYVDNGIADGEELEKLKTIDSHFVEF q9lpd7_arath T12C22.21 T12C22_21 At1g44920 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRMLVLRTPTGPVSAVRFITKSKPSPFSSPDSWLLPAPNTHRSRPRVVLALSNPDGSVNSKPSTSASQIPSSGDETVFVGQDNVPLEGVIQFDKPSSTSSSNITKWGRVALLAGGDVLALLIFSAIGRFSHGFPVFSLDTLHTADPFIAGWFLSAYFLGGYAEEGRGMKGKSKAVVAAAKSWIVGTPLGIIIRSASSGHIPAYSFVLVTMGSTAVLLIGWRALLFSVLPTESKKKDDTYRKGSAFELFELLTSLIRRW tcp8_arath Transcription factor TCP8 TCP8 T15M6.11 T18I24.2 At1g58100 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDLSDIRNNNNDTAAVATGGGARQLVDASLSIVPRSTPPEDSTLATTSSTATATTTKRSTKDRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGETIEWLLQQAEPAIVAATGTGTIPANFSTLSVSLRSSGSTLSAPPSKSVPLYGALGLTHHQYDEQGGGGVFAAHTSPLLGFHHQLQHHQNQNQNQDPVETIPEGENFSRKRYRSVDLSKENDDRKQNENKSLKESETSGPTAAPMWAVAPPSRSGAGNTFWMLPVPTTAGNQMESSSNNNTAAGHRAPPMWPFVNSAGGGAGGGGGAATHFMAGTGFSFPMDQYRGSPLQLGSFLAQPQPTQNLGLSMPDSNLGMLAALNSAYSRGGNANANAEQANNAVEHQEKQQQSDHDDDSREENSNSSE pnm1-nap1;1 1430299 n/a 1430302 unspecified role unspecified role prey prey region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1430303 unspecified role unspecified role bait bait region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false no figure pnm1-q9fir7 1430299 n/a 1430303 unspecified role unspecified role bait bait region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1430304 unspecified role unspecified role prey prey region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false pnm1-t12c22_21 1430299 n/a 1430305 unspecified role unspecified role prey prey region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1430303 unspecified role unspecified role bait bait region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false pnm1-tcp8 1430299 n/a 1430303 unspecified role unspecified role bait bait region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1430306 unspecified role unspecified role prey prey region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false pnm1-nap1;1 1430300 n/a 1430302 unspecified role unspecified role prey prey region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1430303 unspecified role unspecified role bait bait region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 4A pnm1-tcp8-1 1430300 n/a 1430306 unspecified role unspecified role prey prey region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1430303 unspecified role unspecified role bait bait region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 4A nap1;1-pnm1 1430300 n/a 1430303 unspecified role unspecified role prey prey region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1430302 unspecified role unspecified role bait bait region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 4A tcp8-pnm1 1430300 n/a 1430303 unspecified role unspecified role prey prey region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1430306 unspecified role unspecified role bait bait region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 4A pnm1-nap1;1 1430301 n/a 1430303 unspecified role unspecified role neutral component neutral component region bifc tag bifc tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1430302 unspecified role unspecified role neutral component neutral component region bifc tag bifc tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 4B pnm1-tcp8-2 1430301 n/a 1430303 unspecified role unspecified role neutral component neutral component region bifc tag bifc tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1430306 unspecified role unspecified role neutral component neutral component region bifc tag bifc tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 4B