UniProt UniProt http://www.uniprot.org shibagaki-2010-2 Binding of cysteine synthase to the STAS domain of sulfate transporter and its regulatory consequences. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Shibagaki N., Grossman A.R. nshibagaki@mls.eng.osaka-u.ac.jp Arabidopsis thaliana seedling J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation shibagaki-2010-4 Binding of cysteine synthase to the STAS domain of sulfate transporter and its regulatory consequences. tobac-leaf Nicotiana tabacum (tobacco) leaf leaf leaf bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Shibagaki N., Grossman A.R. nshibagaki@mls.eng.osaka-u.ac.jp Arabidopsis thaliana seedling J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation shibagaki-2010-3 Binding of cysteine synthase to the STAS domain of sulfate transporter and its regulatory consequences. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Shibagaki N., Grossman A.R. nshibagaki@mls.eng.osaka-u.ac.jp Arabidopsis thaliana seedling J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation shibagaki-2010-1 Binding of cysteine synthase to the STAS domain of sulfate transporter and its regulatory consequences. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Shibagaki N., Grossman A.R. nshibagaki@mls.eng.osaka-u.ac.jp Arabidopsis thaliana seedling J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation sut12_arath Sulfate transporter 1.2 SULTR1;2 F28K19.22 At1g78000 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSRAHPVDGSPATDGGHVPMKPSPTRHKVGIPPKQNMFKDFMYTFKETFFHDDPLRDFKDQPKSKQFMLGLQSVFPVFDWGRNYTFKKFRGDLISGLTIASLCIPQDIGYAKLANLDPKYGLYSSFVPPLVYACMGSSRDIAIGPVAVVSLLLGTLLRAEIDPNTSPDEYLRLAFTATFFAGITEAALGFFRLGFLIDFLSHAAVVGFMGGAAITIALQQLKGFLGIKKFTKKTDIISVLESVFKAAHHGWNWQTILIGASFLTFLLTSKIIGKKSKKLFWVPAIAPLISVIVSTFFVYITRADKQGVQIVKHLDQGINPSSFHLIYFTGDNLAKGIRIGVVAGMVALTEAVAIGRTFAAMKDYQIDGNKEMVALGMMNVVGSMSSCYVATGSFSRSAVNFMAGCQTAVSNIIMSIVVLLTLLFLTPLFKYTPNAILAAIIINAVIPLIDIQAAILIFKVDKLDFIACIGAFFGVIFVSVEIGLLIAVSISFAKILLQVTRPRTAVLGNIPRTSVYRNIQQYPEATMVPGVLTIRVDSAIYFSNSNYVRERIQRWLHEEEEKVKAASLPRIQFLIIEMSPVTDIDTSGIHALEDLYKSLQKRDIQLILANPGPLVIGKLHLSHFADMLGQDNIYLTVADAVEACCPKLSNEV cysk1_arath Cysteine synthase 1 OASA1 OAS1 OASS At.OAS.5-8 CSase A Cys-3A O-acetylserine sulfhydrylase Beta-substituted Ala synthase 1;1 O-acetylserine (thiol)-lyase 1 OLD3 Protein ONSET OF LEAF DEATH 3 dl3480c At4g14880 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDLIDEVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFVAIFPSFGERYLSTVLFDATRKEAEAMTFEA sut11_arath Sulfate transporter 1.1 SULTR1;1 HST1 AST101 High-affinity sulfate transporter 1 Hst1At T3F12.7 At4g08620 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSGTINPPDGGGSGARNPPVVRQRVLAPPKAGLLKDIKSVVEETFFHDAPLRDFKGQTPAKKALLGIQAVFPIIGWAREYTLRKFRGDLIAGLTIASLCIPQDIGYAKLANVDPKYGLYSSFVPPLIYAGMGSSRDIAIGPVAVVSLLVGTLCQAVIDPKKNPEDYLRLVFTATFFAGIFQAGLGFLRLGFLIDFLSHAAVVGFMGGAAITIALQQLKGFLGIKTFTKKTDIVSVMHSVFKNAEHGWNWQTIVIGASFLTFLLVTKFIGKRNRKLFWVPAIAPLISVIISTFFVFIFRADKQGVQIVKHIDQGINPISVHKIFFSGKYFTEGIRIGGIAGMVALTEAVAIARTFAAMKDYQIDGNKEMIALGTMNVVGSMTSCYIATGSFSRSAVNFMAGVETAVSNIVMAIVVALTLEFITPLFKYTPNAILAAIIISAVLGLIDIDAAILIWRIDKLDFLACMGAFLGVIFISVEIGLLIAVVISFAKILLQVTRPRTTVLGKLPNSNVYRNTLQYPDAAQIPGILIIRVDSAIYFSNSNYVRERASRWVREEQENAKEYGMPAIRFVIIEMSPVTDIDTSGIHSIEELLKSLEKQEIQLILANPGPVVIEKLYASKFVEEIGEKNIFLTVGDAVAVCSTEVAEQQT sultr1_2-oasa1-1 1443269 n/a 1443273 unspecified role unspecified role bait bait stas sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1443274 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1443280 1443278 physical association physical association false false false Fig. 1B sultr1_1-oasa1 1443269 n/a 1443275 unspecified role unspecified role bait bait stas sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false weak interaction n/a 1443274 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1443285 1443283 physical association physical association false false false Fig. 1A sultr1_2-sultr1_2 1443269 n/a 1443273 unspecified role unspecified role bait bait lstas sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1443273 unspecified role unspecified role prey prey lstas sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1443290 1443288 physical association physical association false false false Fig. 1A, S2 oasa1-oasa1 1443270 n/a 1443274 unspecified role unspecified role neutral component neutral component region cgfp cGFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1443274 unspecified role unspecified role neutral component neutral component region ngfp nGFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3C oasa1-sultr1_2-3 1443270 n/a 1443274 unspecified role unspecified role neutral component neutral component region cgfp cGFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1443273 unspecified role unspecified role neutral component neutral component region ngfp nGFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3B sultr1_2-sultr1_2-1 1443270 n/a 1443273 unspecified role unspecified role neutral component neutral component region cgfp cGFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false n/a 1443273 unspecified role unspecified role neutral component neutral component region ngfp nGFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false 1443307 1443304 physical association physical association false false false Fig. 3E oasa1-sultr1_2 1443271 n/a 1443274 unspecified role unspecified role unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) n/a 1443273 unspecified role unspecified role unspecified role unspecified role region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false stas sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 2A, 2B, S1, S2 O-acetylserine oasa1-sultr1_2-1 1443271 n/a 1443274 unspecified role unspecified role unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1443273 unspecified role unspecified role unspecified role unspecified role region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false tobac-leaf Nicotiana tabacum (tobacco) leaf leaf leaf physical association physical association false false false Fig. 2C sultr1_2-oasa1 1443272 n/a 1443274 unspecified role unspecified role prey prey n/a 1443273 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false