UniProt UniProt http://www.uniprot.org tsoporis-2010-2 S100B interaction with the receptor for advanced glycation end products (RAGE): a novel receptor-mediated mechanism for myocyte apoptosis postinfarction. rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tsoporis J.N., Izhar S., Leong-Poi H., Desjardins J.F., Huttunen H.J., Parker T.G. One experiment (demonstrating S100A1 and RAGE coIP) omitted as the respective online Figure I mentioned in the main text cannot be found on the website. parkertg@smh.toronto.on.ca Circ. Res. (0009-7330) 2010 Only protein-protein interactions imex curation tsoporis-2010-1 S100B interaction with the receptor for advanced glycation end products (RAGE): a novel receptor-mediated mechanism for myocyte apoptosis postinfarction. rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] confocal microscopy confocal microscopy immunostaining immunostaining Tsoporis J.N., Izhar S., Leong-Poi H., Desjardins J.F., Huttunen H.J., Parker T.G. One experiment (demonstrating S100A1 and RAGE coIP) omitted as the respective online Figure I mentioned in the main text cannot be found on the website. parkertg@smh.toronto.on.ca Circ. Res. (0009-7330) 2010 Only protein-protein interactions imex curation rage_rat Advanced glycosylation end product-specific receptor Ager Rage Receptor for advanced glycosylation end products protein protein rat Rattus norvegicus (Rat) Rat MPTGTVARAWVLVLALWGAVAGGQNITARIGEPLMLSCKGAPKKPTQKLEWKLNTGRTEAWKVLSPQGDPWDSVARILPNGSLLLPAIGIVDEGTFRCRATNRLGKEVKSNYRVRVYQIPGKPEIVNPASELTANVPNKVGTCVSEGSYPAGTLSWHLDGKPLIPDGKGTVVKEETRRHPETGLFTLRSELTVTPAQGGTTPTYSCSFSLGLPRRRPLNTAPIQPRVREPLPPEGIQLLVEPEGGTVAPGGTVTLTCAISAQPPPQIHWIKDGTPLPLAPSPVLLLPEVGHEDEGIYSCVATHPSHGPQESPPVNIRVTETGDEGQAAGSVDGSGLGTLALALGILGGLGIAALLIGAILWRKRQPRLEERKAPESQEDEEERAELNQSEEAEMPENGAGGP s100b_rat Protein S100-B S100b S100 calcium-binding protein B S-100 protein subunit beta S-100 protein beta chain protein protein rat Rattus norvegicus (Rat) Rat MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE s100b-ager 1354270 n/a 1354272 unspecified role unspecified role prey prey n/a 1354273 unspecified role unspecified role bait bait physical association physical association false false false 3Bi ager-s100b-2 1354270 n/a 1354272 unspecified role unspecified role bait bait n/a 1354273 unspecified role unspecified role prey prey physical association physical association false false false 3Bii ager-s100b-1 1354271 n/a 1354273 unspecified role unspecified role neutral component neutral component n/a 1354272 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 3a