mbinfo MBInfo http://www.mechanobio.info/ http://www.mechanobio.info/ deakin-2009-1 An integrin-alpha4-14-3-3zeta-paxillin ternary complex mediates localised Cdc42 activity and accelerates cell migration. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Deakin N.O., Bass M.D., Warwood S., Schoelermann J., Mostafavi-Pour Z., Knight D., Ballestrem C., Humphries M.J. Interaction detection: GST pull down. Interactions including Integrins have not been included as either the species of origin is not known, and/or the molecules are parts of artificial constructs, which are not usually curated by this database. martin.humphries@manchester.ac.uk J. Cell. Sci. (0021-9533) 2009 Only protein-protein interactions imex curation FRET experiments (Fig. 3,4,5,7, S2 and S3) and coimmunoprecipitation experiments (Fig 6C) involving recombinant integrin alpha-4 or integrin alpha-5/alpha-4 chimera could not be curated since the source of integrin alpha-4 was not specified and could not be identified. deakin-2009-2 An integrin-alpha4-14-3-3zeta-paxillin ternary complex mediates localised Cdc42 activity and accelerates cell migration. crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Deakin N.O., Bass M.D., Warwood S., Schoelermann J., Mostafavi-Pour Z., Knight D., Ballestrem C., Humphries M.J. Interaction detection: GST pull down. Interactions including Integrins have not been included as either the species of origin is not known, and/or the molecules are parts of artificial constructs, which are not usually curated by this database. martin.humphries@manchester.ac.uk J. Cell. Sci. (0021-9533) 2009 Only protein-protein interactions imex curation FRET experiments (Fig. 3,4,5,7, S2 and S3) and coimmunoprecipitation experiments (Fig 6C) involving recombinant integrin alpha-4 or integrin alpha-5/alpha-4 chimera could not be curated since the source of integrin alpha-4 was not specified and could not be identified. p130cas_crigr_protein p130Cas protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster g3hvn3_crigr I79_015011 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MEHIQGAWKSISNGFGLKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDSSKTSNTIRVFLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLQEHKGKKARLDWNTDAASLIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPTMCVDWSNIRQLLLFPNSTVGDSGVPALPSLTMRRMRESVSRMPASSQHRYSTPHAFTFNTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPGSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQLQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSRLYKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF g3gu78_crigr I79_001232 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MKLLLLVTLLTARAIAQNISLQAVWQFGNAFECILPLPVPTKEYTAYGCYCGLSSWIPFLEDLDPCCRARDNCYAQVDYLGNCALLIRNPYTSSYSYSCSGTEITCSDALLADLESTTSHISKRPVFLSEEPPYSYPTGNHTYQETAVPPPVPPPPSSEALNGTILDPLDQWQPSGSRYTHQQPPSPSPVYSSSAKTSGASNPQDSALCSRAGEEEHVYSFPNKHKSAEPSPTMMSSSLGNNLSELDRLLLELNAVQHNPSGFPAESNSTLGGKTGPLMKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQRVTSSQQQTRISASSATRELDELMASLSDFKTSSSAVVLSSQGLLPSSTPFLPITLLHPPPPTKFSHGGHTPMVLNREGNSQVLLPSGAPRRLDLVSLKGTSGTPNSWCPSGEGSQQSFGAKSQAQVRNDLTDSMTKPFQTPLCHTLHPAVSTGSQGPLASYVCSEETVAPVERWPQAVPGSRPEIPPGVTYSIQEGTEPAVMAVDRQAVLPDTWSLTKECGQQERAQSEPEGLESSCPAPANEEQLGGKIPWRGSLGGPTQALENPRNPEGATKATLEARKEEPEFPHAGVMGTPNTSERISTAGQAGSSLCSH 1433z_human 14-3-3 protein zeta/delta YWHAZ Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN g3hkz1_crigr I79_011374 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIEAELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN ywhaz-g3gu78 1434867 n/a 1434869 unspecified role unspecified role prey prey crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 1434870 unspecified role unspecified role prey prey crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 1434871 unspecified role unspecified role prey prey crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 1434872 unspecified role unspecified role bait bait n-terminal region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) association association false false false Fig 6A. ywhaz-raf1-1 1434867 n/a 1434870 unspecified role unspecified role prey prey crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 1434872 unspecified role unspecified role bait bait n-terminal region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) association association false false false Fig 6C. Though integrin alpha-4/alpha-5 mutants were also precipitated with 14-3-3 zeta, the interaction could not be curated since the source of integrin alpha-4 was not specified and could not be identified. g3gu78-g3hkz1 1434868 n/a 1434873 unspecified role unspecified role prey prey n/a 1434871 unspecified role unspecified role bait bait physical association physical association false false false Fig 6B.