UniProt UniProt http://www.uniprot.org hahn-2009-1 Kaposi's sarcoma-associated herpesvirus gH/gL: glycoprotein export and interaction with cellular receptors. human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hahn A., Birkmann A., Wies E., Dorer D., Mahr K., Stürzl M., Titgemeyer F., Neipel F. A KSHV gH-Fc fusion construct w human IgG1 has been used to express the gH soluble ectodomain and detected with anti -Fc antibody. The origin of the human cell line used for CoIP (fig 2) could not be established from the publication. Colocalization images are found on http://www.viro.med.uni-erlangen.de/supplement/jvi/JVI01170-08/suppl-fig.pdf Frank .neipel@viro.med.uni-erlangen.de Frank.neipel@viro.med.uni-erlangen.de J. Virol. (0022-538X) 2009 mimix curation hahn-2009-2 Kaposi's sarcoma-associated herpesvirus gH/gL: glycoprotein export and interaction with cellular receptors. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy anti tag immunost anti tag immunostaining anti tag immunost Hahn A., Birkmann A., Wies E., Dorer D., Mahr K., Stürzl M., Titgemeyer F., Neipel F. A KSHV gH-Fc fusion construct w human IgG1 has been used to express the gH soluble ectodomain and detected with anti -Fc antibody. The origin of the human cell line used for CoIP (fig 2) could not be established from the publication. Colocalization images are found on http://www.viro.med.uni-erlangen.de/supplement/jvi/JVI01170-08/suppl-fig.pdf Frank .neipel@viro.med.uni-erlangen.de Frank.neipel@viro.med.uni-erlangen.de J. Virol. (0022-538X) 2009 mimix curation q98142_hhv8 Envelope glycoprotein H ORF22 gH HHV8GK18_gp26 protein protein hhv8 Human herpesvirus 8 (HHV-8) Kaposi's sarcoma-associated herpesvirus HHV-8 MQGLAFLAALACWRCISLTCGATGALPTTATTITRSATQLINGRTNLSIELEFNGTSFFLNWQNLLNVITEPALTELWTSAEVAEDLRVTLKKRQSLFFPNKTVVISGDGHRYTCEVPTSSQTYNITKGFNYSALPGHLGGFGINARLVLGDIFASKWSLFARDTPEYRVFYPMNVMAVKFSISIGNNESGVALYGVVSEDFVVVTLHNRSKEANETASHLLFGLPDSLPSLKGHATYDELTFARNAKYALVAILPKDSYQTLLTENYTRIFLNMTESTPLEFTRTIQTRIVSIEARRACAAQEAAPDIFLVLFQMLVAHFLVARGIAEHRFVEVDCVCRQYAELYFLRRISRLCMPTFTTVGYNHTTLGAVAATQIARVSATKLASLPRSSQETVLAMVQLGARDGAVPSSILEGIAMVVEHMYTAYTYVYTLGDTERKLMLDIHTVLTDSCPPKDSGVSEKLLRTYLMFTSMCTNIELGEMIARFSKPDSLNIYRAFSPCFLGLRYDLHPAKLRAEAPQSSALTRTAVARGTSGFAELLHALHLDSLNLIPAINCSKITADKIIATVPLPHVTYIISSEALSNAVVYEVSEIFLKSAMFISAIKPDCSGFNFSQIDRHIPIVYNISTPRRGCPLCDSVIMSYDESDGLQSLMYVTNERVQTNLFLDKSPFFDNNNLHIHYLWLRDNGTVVEIRGMYRRRAASALFLILSFIGFSGVIYFLYRLFSILY q76rg7_hhv8 Envelope glycoprotein L ORF47 ORF46 gL HHV8GK18_gp49 protein protein hhv8 Human herpesvirus 8 (HHV-8) Kaposi's sarcoma-associated herpesvirus HHV-8 MGIFALFAVLWTTLLVTSHAYVALPCCAIQASAASTLPLFFAVHSIHFADPNHCNGVCIAKLRSKTGDITVETCVNGFNLRSFLVAVVRRLGSWASQENLRLLWYLQRSLTAYTVGFNATTADSSIHNVNIIIISVGKAMNRTGSVSGSQTRAKSSSRRAHAGQKGK orf22-gl-1 1455463 n/a 1455465 unspecified role unspecified role bait bait c-terminal fc-igg1 fc-igg1 c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1455466 unspecified role unspecified role prey prey c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 2 orf22-orf46 1455464 n/a 1455465 unspecified role unspecified role neutral component neutral component c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal fc-igg1 fc-igg1 c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1455466 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false supplemental figure