UniProt UniProt http://www.uniprot.org ramachandran-2008-1 STAT2 is a primary target for measles virus V protein-mediated alpha/beta interferon signaling inhibition. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ramachandran A., Parisien J.P., Horvath C.M. Measles virus Edmonston ATCC strain has been used for which no sequence is available. Data have been mapped to the measles virus referenence proteome strain instead. horvath@northwestern.edu J. Virol. (0022-538X) 2008 mimix curation ramachandran-2008-2 STAT2 is a primary target for measles virus V protein-mediated alpha/beta interferon signaling inhibition. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down western blot western blot Immuno blot Immuno blot Ramachandran A., Parisien J.P., Horvath C.M. Measles virus Edmonston ATCC strain has been used for which no sequence is available. Data have been mapped to the measles virus referenence proteome strain instead. horvath@northwestern.edu J. Virol. (0022-538X) 2008 mimix curation ramachandran-2008-3 STAT2 is a primary target for measles virus V protein-mediated alpha/beta interferon signaling inhibition. human-2ftgh Human 2fTGH cells 2ftgh 2fTGH parental cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ramachandran A., Parisien J.P., Horvath C.M. Measles virus Edmonston ATCC strain has been used for which no sequence is available. Data have been mapped to the measles virus referenence proteome strain instead. horvath@northwestern.edu J. Virol. (0022-538X) 2008 mimix curation ramachandran-2008-4 STAT2 is a primary target for measles virus V protein-mediated alpha/beta interferon signaling inhibition. human-u3a Homo sapiens STAT1 -/- fibrosarcma line u3a STAT1 -/- fibrosarcma line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ramachandran A., Parisien J.P., Horvath C.M. Measles virus Edmonston ATCC strain has been used for which no sequence is available. Data have been mapped to the measles virus referenence proteome strain instead. horvath@northwestern.edu J. Virol. (0022-538X) 2008 mimix curation v_measc Non-structural protein V P/V protein protein measc measles virus (strai MAEEQARHVKNGLECIRALKAEPIGSLAVEEAMAAWSEISDNPGQDRATCKEEEAGSSGLSKPCLSAIGSTEGGAPRIRGQGSGESDDDAETLGIPSRNLQASSTGLQCYHVYDHSGEAVKGIQDADSIMVQSGLDGDSTLSGGDDESENSDVDIGEPDTEGYAITDRGSAPISMGFRASDVETAEGGEIHELLKLQSRGNNFPKLGKTLNVPPPPNPSRASTSETPIKKGHRREIGLIWNGDRVFIDRWCNPMCSKVTLGTIRARCTCGECPRVCEQCRTDTGVDTRIWYHNLPEIPE stat1_human Signal transducer and activator of transcription 1-alpha/beta STAT1 Transcription factor ISGF-3 components p91/p84 protein protein human Homo sapiens Human MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWKRRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQVLWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKVKVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTNEGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAEPRNLSFFLTPPCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWTRFCKENINDKNFPFWLWIESILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEFDSMMNTV stat2_human Signal transducer and activator of transcription 2 p113 STAT2 protein protein human Homo sapiens Human MAQWEMLQNLDSPFQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEAALGSDDSKATMLFFHFLDQLNYECGRCSQDPESLLLQHNLRKFCRDIQPFSQDPTQLAEMIFNLLLEEKRILIQAQRAQLEQGEPVLETPVESQQHEIESRILDLRAMMEKLVKSISQLKDQQDVFCFRYKIQAKGKTPSLDPHQTKEQKILQETLNELDKRRKEVLDASKALLGRLTTLIELLLPKLEEWKAQQQKACIRAPIDHGLEQLETWFTAGAKLLFHLRQLLKELKGLSCLVSYQDDPLTKGVDLRNAQVTELLQRLLHRAFVVETQPCMPQTPHRPLILKTGSKFTVRTRLLVRLQEGNESLTVEVSIDRNPPQLQGFRKFNILTSNQKTLTPEKGQSQGLIWDFGYLTLVEQRSGGSGKGSNKGPLGVTEELHIISFTVKYTYQGLKQELKTDTLPVVIISNMNQLSIAWASVLWFNLLSPNLQNQQFFSNPPKAPWSLLGPALSWQFSSYVGRGLNSDQLSMLRNKLFGQNCRTEDPLLSWADFTKRESPPGKLPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRSQERRLLKKTMSGTFLLRFSESSEGGITCSWVEHQDDDKVLIYSVQPYTKEVLQSLPLTEIIRHYQLLTEENIPENPLRFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSNRQVDELQQPLELKPEPELESLELELGLVPEPELSLDLEPLLKAGLDLGPELESVLESTLEPVIEPTLCMVSQTVPEPDQGPVSQPVPEPDLPCDLRHLNTEPMEIFRNCVKIEEIMPNGDPLLAGQNTVDEVYVSRPSHFYTDGPLMPSDF p_v-stat1-1 1383447 n/a 1383451 unspecified role unspecified role bait bait n/a 1383452 unspecified role unspecified role prey prey n/a 1383453 unspecified role unspecified role prey prey association association false false false 2B and F, 3B, 4B p_v-stat1-1 1383448 n/a 1383451 unspecified role unspecified role bait bait n/a 1383453 unspecified role unspecified role prey prey physical association physical association false false false 2C p_v-stat1-1 1383449 n/a 1383451 unspecified role unspecified role bait bait n/a 1383452 unspecified role unspecified role prey prey n/a 1383453 unspecified role unspecified role prey prey association association false false false 1C p_v-stat1-1 1383450 n/a 1383451 unspecified role unspecified role bait bait n/a 1383453 unspecified role unspecified role prey prey physical association physical association false false false 1C