UniProt UniProt http://www.uniprot.org leclerc-2007-1 S100B and S100A6 differentially modulate cell survival by interacting with distinct RAGE (receptor for advanced glycation end products) immunoglobulin domains. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Leclerc E., Fritz G., Weibel M., Heizmann C.W., Galichet A. arnaud.galichet@kispi.uzh.ch J. Biol. Chem. (0021-9258) 2007 mimix curation s10a1_human Protein S100-A1 S100 calcium-binding protein A1 S-100 protein subunit alpha S-100 protein alpha chain S100A1 S100A protein protein human Homo sapiens Human MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS rage_human Advanced glycosylation end product-specific receptor AGER RAGE Receptor for advanced glycosylation end products protein protein human Homo sapiens Human MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGGLGTAALLIGVILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP s100b_human Protein S100-B S100B S100 calcium-binding protein B S-100 protein subunit beta S-100 protein beta chain protein protein human Homo sapiens Human MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE ager-s100a1 1354260 n/a 1354261 unspecified role unspecified role prey prey n/a 1354262 unspecified role unspecified role bait bait Soluble AGER (sRAGE) has been used. sRAGE is procuced by proteolytic cleavage and/or alternative splicing and cannot be mapped to a UniProt AcNo. direct interaction direct interaction false false false 1 ager-s100b 1354260 n/a 1354263 unspecified role unspecified role prey prey n/a 1354262 unspecified role unspecified role bait bait Soluble AGER (sRAGE) has been used. sRAGE is procuced by proteolytic cleavage and/or alternative splicing and cannot be mapped to a UniProt AcNo. direct interaction direct interaction false false false 1