UniProt UniProt http://www.uniprot.org silvaggi-2006-1 The X-ray crystal structures of human alpha-phosphomannomutase 1 reveal the structural basis of congenital disorder of glycosylation type 1a. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Silvaggi N.R., Zhang C., Lu Z., Dai J., Dunaway-Mariano D., Allen K.N. allen@med-xtal.bu.edu J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation magnesium(2+) Magnesium(2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) pmm1_human Phosphomannomutase 1 PMMH-22 PMM1 PMMH22 protein protein human Homo sapiens Human MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQLGDGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFPETAHEA alpha-d-mannose 1-phosphate alpha-D-mannose 1-phosphate 1-O-phosphono-alpha-D-mannopyranose alpha-D-mannose 1-phosphate alpha-D-Mannose 1-phosphate alpha-D-mannopyranose 1-(dihydrogen phosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) HXXFSFRBOHSIMQ-RWOPYEJCSA-N magnesium_2__-pmm1-2 1449646 n/a 1449647 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 n/a 1449648 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false Fig 3 2.10 A R-factor: 0.187; R-free: 0.206 alpha_d_mannose_1_phosphate-magnesium_2__-1 1449646 n/a 1449647 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 n/a 1449648 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a 1449649 unspecified role unspecified role neutral component neutral component Stoichiometry: 1.0 direct interaction direct interaction false false false Fig 3 1.75 A R-factor:0.204; R-free: 0.240