UniProt UniProt http://www.uniprot.org li-2006m-1 Crystal structure of human guanosine monophosphate reductase 2 (GMPR2) in complex with GMP. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Li J., Wei Z., Zheng M., Gu X., Deng Y., Qiu R., Chen F., Ji C., Gong W., Xie Y., Mao Y. wgong@ibp.ac.cn J. Mol. Biol. (0022-2836) 2006 Only protein-protein interactions imex curation gmpr2_human GMP reductase 2 Guanosine 5'-monophosphate oxidoreductase 2 GMPR2 protein protein human Homo sapiens Human MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEAC gmp GMP 5'-GMP GMP Guanosine 5'-monophosphate Guanosine 5'-phosphate Guanosine monophosphate guanosine-5'-monophosphate Guanylic acid pG 5'-guanylic acid [(2R,3S,4R,5R)-5-(2-amino-6-oxo-1,6-dihydro-9H-purin-9-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen phosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) RQFCJASXJCIDSX-UUOKFMHZSA-N gmp-gmpr2-1 1467762 n/a 1467763 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 4.0 n/a 1467764 unspecified role unspecified role neutral component neutral component Stoichiometry: 3.0 direct interaction direct interaction false false false R-factor:0.228 R-free:0.276 3.0 A Fig 1