UniProt UniProt http://www.uniprot.org johnston-2005-1 Myxoma virus M-T5 protects infected cells from the stress of cell cycle arrest through its interaction with host cell cullin-1. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Johnston J.B., Wang G., Barrett J.W., Nazarian S.H., Colwill K., Moran M., McFadden G. mcfadden@robarts.ca J. Virol. (0022-538X) 2005 Only protein-protein interactions imex curation johnston-2005-2 Myxoma virus M-T5 protects infected cells from the stress of cell cycle arrest through its interaction with host cell cullin-1. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down western blot western blot Immuno blot Immuno blot Johnston J.B., Wang G., Barrett J.W., Nazarian S.H., Colwill K., Moran M., McFadden G. mcfadden@robarts.ca J. Virol. (0022-538X) 2005 Only protein-protein interactions imex curation johnston-2005-3 Myxoma virus M-T5 protects infected cells from the stress of cell cycle arrest through its interaction with host cell cullin-1. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Johnston J.B., Wang G., Barrett J.W., Nazarian S.H., Colwill K., Moran M., McFadden G. mcfadden@robarts.ca J. Virol. (0022-538X) 2005 Only protein-protein interactions imex curation johnston-2005-4 Myxoma virus M-T5 protects infected cells from the stress of cell cycle arrest through its interaction with host cell cullin-1. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Johnston J.B., Wang G., Barrett J.W., Nazarian S.H., Colwill K., Moran M., McFadden G. mcfadden@robarts.ca J. Virol. (0022-538X) 2005 Only protein-protein interactions imex curation johnston-2005-5 Myxoma virus M-T5 protects infected cells from the stress of cell cycle arrest through its interaction with host cell cullin-1. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down anti tag western anti tag western blot anti tag western Johnston J.B., Wang G., Barrett J.W., Nazarian S.H., Colwill K., Moran M., McFadden G. mcfadden@robarts.ca J. Virol. (0022-538X) 2005 Only protein-protein interactions imex curation cul1_human Cullin-1 CUL1 protein protein human Homo sapiens Human MSSTRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA mt5_myxvl Ankyrin repeat domain-containing protein M-T5 m005R m005L M-T5 protein protein protein myxvl Myxoma virus (strain Lausanne) MDLYGYVSCTPRIRHDVLDGLLNVYDPDELCSRDTPFRLYLTRYDCTPEGLRLFLTRGADVNGVRGSRTSPLCTVLSNKDLGNEAEALAKQLIDAGADVNAMAPDGRYPLLCLLENDRINTARFVRYMIDRGTSVYVRGTDGYGPVQTYIHSKNVVLDTLRELVRAGATVHDPDKTYGFNVLQCYMIAHVRSSNVQILRFLLRHGVDSSRGLHATVMFNTLERKISHGVFNRKVLDFIFTQISINEQNSLDFTPINYCVIHNDRRTFDYLLERGADPNVVNFLGNSCLDLAVLNGNKYMVHRLLRKTITPDAYTRALNVVNSNIYSIKSYGMSEFVKRHGTLYKALIRSFVKDSDREIFTYVHIYDYFREFVDECIRERDAMKADVLDAVSVFDTAFGLVARPRWKHVRILSKYVRGVYGDRVKKILRSLHKRRFKTDRLVRRIADLCGPDGLWTRLPVEVRYSVVDYLTDDEIHDLFVKIHA m005r-cul1 1420269 n/a 1420274 unspecified role unspecified role prey prey n/a 1420275 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2A m005r-cul1-1 1420270 n/a 1420274 unspecified role unspecified role prey prey n/a 1420275 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 2B m005r-cul1-2 1420271 n/a 1420275 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1420274 unspecified role unspecified role prey prey physical association physical association false false false 2D cul1-m005r-1 1420272 n/a 1420274 unspecified role unspecified role neutral component neutral component n/a 1420275 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false 3I cul1-m005r 1420273 n/a 1420274 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminal tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1420275 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2C