UniProt UniProt http://www.uniprot.org bravo-2005-2 Four distinct classes of proteins as interaction partners of the PABC domain of Arabidopsis thaliana Poly(A)-binding proteins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bravo J., Aguilar-Henonin L., Olmedo G., Guzmán P. pguzman@ira.cinvestav.mx Mol. Genet. Genomics (1617-4615) 2005 Only protein-protein interactions imex curation bravo-2005-1 Four distinct classes of proteins as interaction partners of the PABC domain of Arabidopsis thaliana Poly(A)-binding proteins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Bravo J., Aguilar-Henonin L., Olmedo G., Guzmán P. pguzman@ira.cinvestav.mx Mol. Genet. Genomics (1617-4615) 2005 Only protein-protein interactions imex curation pabp2_arath Polyadenylate-binding protein 2 PAB2 F28A23.130 At4g34110 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAQVQLQGQTPNGSTAAVTSAPATSGGATATQFGNTSLYVGDLDFNVTDSQLFDAFGQMGTVVTVRVCRDLVTRRSLGYGYVNFTNPQDAARAIQELNYIPLYGKPIRVMYSHRDPSVRRSGAGNIFIKNLDESIDHKALHDTFSSFGNIVSCKVAVDSSGQSKGYGFVQYANEESAQKAIEKLNGMLLNDKQVYVGPFLRRQERDSTANKTKFTNVYVKNLAESTTDDDLKNAFGEYGKITSAVVMKDGEGKSKGFGFVNFENADDAARAVESLNGHKFDDKEWYVGRAQKKSERETELRVRYEQNLKEAADKFQSSNLYVKNLDPSISDEKLKEIFSPFGTVTSSKVMRDPNGTSKGSGFVAFATPEEATEAMSQLSGKMIESKPLYVAIAQRKEDRRVRLQAQFSQVRPVAMQPSVGPRMPVYPPGGPGIGQQMFYGQAPPAMIPPQPGYGYQQQLVPGMRPGGGPVPSFFMPMVQPQQQRPGGGRRPGGIQHSQQQNPMMQQQMHPRGRMFRYPQGRGGSGDVPPYDMGNNMPLTIGALASNLSNATPEQQRTMLGEVLYPLVEQVEAESAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRSVAAGGATEQLASLNLS erd15_arath Protein EARLY RESPONSIVE TO DEHYDRATION 15 ERD15 CID1 LSR1 Protein CTC-INTERACTING DOMAIN 1 Protein LIGHT STRESS-REGULATED 1 F13H10.2 T26J13.2 At2g41430 PAM2-containing protein CID1 Polyadenylate-binding protein-interacting protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAMVSGRRSTLNPDAPLFIPAAVRQVEDFSPEWWQLVTTSTWYPDYWISQQQQGADGFYDNGENENGGGHIDVADLLPESFDFDDMEDFFDTDAAEFDQGFDGRMYYQAPSEFGFGKNGEMVKKSSGNRSPRSIVEPAKYAEKPAKWGNQRVAAAPRNIHQPR cid7_arath Polyadenylate-binding protein-interacting protein 7 CID7 PAM2-containing protein CID7 Protein CTC-INTERACTING DOMAIN 7 T1D16.8 At2g26280 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSLTKKASEPKLSGTSIKPTTLNPHAAEFVPFTLRSPSSGGTSTLDTRLLASSSSVGKAVLDRTESSASHHSDEEARQFWSHQLPDDITPDFGLMTQDDNSYGSGSLSLANLSLFDGNEAEKFPSASGGYGFSDQTGLASHNANGNSLADKSRYPISSFGEDPQRQSFMQLSPKPWDKQIMNAEQLLGNDRERNPFSGKSRHGFVNDMITESPGDMEVNPVDFLASQFPGFAAESLAEVYFANGCDLQLTIEMLTQLELQVDGGLNQNISPKTYAPPSLTPMDFPALSISNSHGIPAQFGGDDLQQTGNHYQSPEKDNMFFFKSGPSVSQPGAIDYVSAVRKLASQDSGMWKYERNDSADSSIGSSRNSGAYKSGRGRSIYSDKLQSRAQTRPAPVWVETGDAVGNMYSELREEARDYARLRNVYFEQARQAYLVGNKALAKELSVKGQLHNMQMKAAHGKAQEAIYRQRNPVGQGNSRGNERMIDLHGLHVSEALQVLKHELSVLRSTARATQERLQIYICVGTGHHTRGSRTPARLPVAVQRYLLEEEGLDYSEPQAGLLRVIIY pabp5_arath Polyadenylate-binding protein 5 PAB5 F14O23.15 At1g71770 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAAAVASGIAPTTAMVDQVIPNQPTVAAAAPPPFPAVSQVAAVAAAAAAAEALQTHPNSSLYVGDLDPSVNESHLLDLFNQVAPVHNLRVCRDLTHRSLGYAYVNFANPEDASRAMESLNYAPIRDRPIRIMLSNRDPSTRLSGKGNVFIKNLDASIDNKALYETFSSFGTILSCKVAMDVVGRSKGYGFVQFEKEETAQAAIDKLNGMLLNDKQVFVGHFVRRQDRARSESGAVPSFTNVYVKNLPKEITDDELKKTFGKYGDISSAVVMKDQSGNSRSFGFVNFVSPEAAAVAVEKMNGISLGEDVLYVGRAQKKSDREEELRRKFEQERISRFEKLQGSNLYLKNLDDSVNDEKLKEMFSEYGNVTSCKVMMNSQGLSRGFGFVAYSNPEEALLAMKEMNGKMIGRKPLYVALAQRKEERQAHLQSLFTQIRSPGTMSPVPSPMSGFHHHPPGGPMSGPHHPMFIGHNGQGLVPSQPMGYGYQVQFMPGMRPGAGPPNFMMPFPLQRQTQPGPRVGFRRGANNMQQQFQQQQMLQQNASRFMGGAGNRRNGMEASAPQGIIPLPLNASANSHNAPQRSHKPTPLTISKLASDLALASPDKHPRMLGDHLYPLVEQQEPANAAKVTGMLLEMDQAEILHLLESPEALKAKVSEALDVLRRSADPAAVSSVDDQFALSSSE cid4_arath Polyadenylate-binding protein-interacting protein 4 CID4 PAM2-containing protein CID4 Protein CTC-INTERACTING DOMAIN 4 MDC16.14 At3g14010 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSIPQSKSSSNGFPLKRGETEEVLHKTNTSNTVFNGEAGSLKRLSLDRLVYFTTCKIGHHVEVHLRNGSVYTGIFHAANVEKDFGIILKMACLIKDGTLRGHKSRSEFVRKPPSKTFIIPADELVQVIAKDLSVSSNNMSNAVQGEKPSELLTDSSISQSYHVDRERQLQRWVPDETIPHGADLENVFDNPWNRKWNQFEVNKSLFGVKSTFDEDLYTTRLERGPQTKQLEEHAQKIAREIEAETTRDIHVAEERGLQLNENFDFDEEARYSSVRPVTGFGDSGFDLEDNALLDTCNDLTFGGSSTSDGQKPASSGKGCEELRVSGDSQSSRKNKNVDQSCSTSKQQSKDFPAAGSNISESQLDEQRRKNNEEVSHNNRSAEESTSGHGDIKEGAKSGGGASSVSKAVTEREREASQVSSKTKSESSFGQSASRSSESRPGPSTSSRPGLSPSSSIGSMASSEKSTLNPNAKEFKLNPKAKSFKPLQSAAAPPQSPIADASFYYPGPSHVPVQQMPGMPPVNYGLPPYPGNQPQMMYHPQAYYHPNGQPQYPQQQMIPGQQQQQMIPGQQHPRPVYYMHPPPYPQDMPYHNKGRE cid5_arath Polyadenylate-binding protein-interacting protein 5 CID5 IPD1 PAM2-containing protein CID5 Protein CTC-INTERACTING DOMAIN 5 Protein INCREASED POLYPLOIDY LEVEL IN DARKNESS 1 F15N18_30 At5g11440 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKPGAFALNPHAASYVPISKRVDYGGGDDGLVFAAKSPTVEVSMPKKSSEMAYKQIRDDDLDLEMDIDMDIEYLLVTFSGLSQESITDVYLANGGDLEATIEMLNQLEIYSTESEENLPETLDIGDISESGPSTSKSTEVAASTSSVIPNAPVSA cid8_arath Polyadenylate-binding protein-interacting protein 8 CID8 PAM2-containing protein CID8 Protein CTC-INTERACTING DOMAIN 8 F22G10.7 At1g53650 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAAITEMATDSNDVINDGGTGDGIEKSTDSKPEIESDDLKPKSKPEYDQMKKLVAMFKKLNPEAKEFFPSYKRNTNQSDDFVIAIKPSGEDNKKVAINRRRRNNYNQGRRVRLPGRASKAQREDSIRRTVYVSDIDQSVTEEGLAGLFSSCGQVVDCRICGDPNSVLRFAFVEFSDDQGARSALSLGGTMIGYYPVRVLPSKTAILPVNPTFLPRSEDEREMCSRTIYCTNVDKNATEDDVNTFFQSACGEVTRLRLLGDQVHSTRIAFVEFAMAESAVAALNCSGIVLGSQPIRVSPSKTPVRSRITRSPSPN pab2-erd15-1 1385045 n/a 1385047 unspecified role unspecified role bait bait c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1385048 unspecified role unspecified role prey prey pam2 motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false pam2 motif required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false 1385058 1385056 physical association physical association false false false Fig. 3B, Table 1 pab2-cid7-1 1385045 n/a 1385049 unspecified role unspecified role prey prey pam2 motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1385047 unspecified role unspecified role bait bait c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1385064 1385062 physical association physical association false false false Fig. 3C, Table 1 pab5-cid7 1385045 n/a 1385049 unspecified role unspecified role prey prey pam2 motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1385050 unspecified role unspecified role bait bait c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1385069 1385067 physical association physical association false false false Table 1 pab5-erd15 1385045 n/a 1385050 unspecified role unspecified role bait bait c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1385048 unspecified role unspecified role prey prey pam2 motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1385074 1385072 physical association physical association false false false Table 1 pab5-cid4 1385045 n/a 1385051 unspecified role unspecified role prey prey pam2 motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1385050 unspecified role unspecified role bait bait c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1385079 1385077 physical association physical association false false false Table 1 pab2-cid4 1385045 n/a 1385051 unspecified role unspecified role prey prey pam2 motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1385047 unspecified role unspecified role bait bait c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1385084 1385082 physical association physical association false false false Table 1 pab2-cid5 1385045 n/a 1385052 unspecified role unspecified role prey prey pam2 motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1385047 unspecified role unspecified role bait bait c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1385089 1385087 physical association physical association false false false Table 1 pab5-cid5 1385045 n/a 1385052 unspecified role unspecified role prey prey pam2 motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1385050 unspecified role unspecified role bait bait c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1385094 1385092 physical association physical association false false false Table 1 pab2-cid8 1385045 n/a 1385053 unspecified role unspecified role prey prey pam2 motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1385047 unspecified role unspecified role bait bait c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1385099 1385097 physical association physical association false false false Table 1 pab5-cid8 1385045 n/a 1385053 unspecified role unspecified role prey prey pam2 motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1385050 unspecified role unspecified role bait bait c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1385104 1385102 physical association physical association false false false Table 1 pab2-erd15 1385046 n/a 1385047 unspecified role unspecified role bait bait c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1385048 unspecified role unspecified role prey prey physical association physical association false false false pab2-cid7 1385046 n/a 1385047 unspecified role unspecified role bait bait c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1385049 unspecified role unspecified role prey prey physical association physical association false false false