UniProt UniProt http://www.uniprot.org kokura-2003-2 The Ski-binding protein C184M negatively regulates tumor growth factor-beta signaling by sequestering the Smad proteins in the cytoplasm. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Kokura K., Kim H., Shinagawa T., Khan M.M., Nomura T., Ishii S. Origin of Ski according pmid 10049357. Exp using Smad 2 and Smad4 constructs (fig 5) omitted as species origin of the proteins cannot be established from the publication. sishii@rtc.riken.go.jp J. Biol. Chem. (0021-9258) 2003 mimix curation kokura-2003-1 The Ski-binding protein C184M negatively regulates tumor growth factor-beta signaling by sequestering the Smad proteins in the cytoplasm. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kokura K., Kim H., Shinagawa T., Khan M.M., Nomura T., Ishii S. Origin of Ski according pmid 10049357. Exp using Smad 2 and Smad4 constructs (fig 5) omitted as species origin of the proteins cannot be established from the publication. sishii@rtc.riken.go.jp J. Biol. Chem. (0021-9258) 2003 mimix curation kokura-2003-3 The Ski-binding protein C184M negatively regulates tumor growth factor-beta signaling by sequestering the Smad proteins in the cytoplasm. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kokura K., Kim H., Shinagawa T., Khan M.M., Nomura T., Ishii S. Origin of Ski according pmid 10049357. Exp using Smad 2 and Smad4 constructs (fig 5) omitted as species origin of the proteins cannot be established from the publication. sishii@rtc.riken.go.jp J. Biol. Chem. (0021-9258) 2003 mimix curation kokura-2003-4 The Ski-binding protein C184M negatively regulates tumor growth factor-beta signaling by sequestering the Smad proteins in the cytoplasm. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kokura K., Kim H., Shinagawa T., Khan M.M., Nomura T., Ishii S. Origin of Ski according pmid 10049357. Exp using Smad 2 and Smad4 constructs (fig 5) omitted as species origin of the proteins cannot be established from the publication. sishii@rtc.riken.go.jp J. Biol. Chem. (0021-9258) 2003 mimix curation kokura-2003-5 The Ski-binding protein C184M negatively regulates tumor growth factor-beta signaling by sequestering the Smad proteins in the cytoplasm. chlae-cv-1 Monkey African Green kidney fibroblast Grivet cv-1 Monkey African Green kidney fibroblast confocal microscopy confocal microscopy immunostaining immunostaining Kokura K., Kim H., Shinagawa T., Khan M.M., Nomura T., Ishii S. Origin of Ski according pmid 10049357. Exp using Smad 2 and Smad4 constructs (fig 5) omitted as species origin of the proteins cannot be established from the publication. sishii@rtc.riken.go.jp J. Biol. Chem. (0021-9258) 2003 mimix curation lra25_mouse Leucine repeat adapter protein 25 Fam89b Mtvr2 C184L ORF2 protein C184M protein C184m MMTV receptor Lrap25 protein protein mouse Mus musculus Mouse MNGLPATEAPGGAGCALAGLPPLPRGLSGLLNASGGSWRELERVYSQRSRIHDELSRAARAPDGPRHAAGSANSGSAAGPRRPVNLDSALAALRKEMVGLRQLDMSLLCQLWGLYESIQDYKHLCQDLSLCQDLSSSLHSDSSYPPDAGLSDDEEPPDASLPPDPPPLTVPQTHNARDQWLQDAFQISL ski_human Ski oncogene SKI Proto-oncogene c-Ski protein protein human Homo sapiens Human MEAAAGGRGCFQPHPGLQKTLEQFHLSSMSSLGGPAAFSARWAQEAYKKESAKEAGAAAVPAPVPAATEPPPVLHLPAIQPPPPVLPGPFFMPSDRSTERCETVLEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINAVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALLYGGAYPPPCKKELAASLALGLELSERSVRVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKALENRTCHWGFDSANWRAYILLSQDYTGKEEQARLGRCLDDVKEKFDYGNKYKRRVPRVSSEPPASIRPKTDDTSSQSPAPSEKDKPSSWLRTLAGSSNKSLGCVHPRQRLSAFRPWSPAVSASEKELSPHLPALIRDSFYSYKSFETAVAPNVALAPPAQQKVVSSPPCAAAVSRAPEPLATCTQPRKRKLTVDTPGAPETLAPVAAPEEDKDSEAEVEVESREEFTSSLSSLSSPSFTSSSSAKDLGSPGARALPSAVPDAAAPADAPSGLEAELEHLRQALEGGLDTKEAKEKFLHEVVKMRVKQEEKLSAALQAKRSLHQELEFLRVAKKEKLREATEAKRNLRKEIERLRAENEKKMKEANESRLRLKRELEQARQARVCDKGCEAGRLRAKYSAQIEDLQVKLQHAEADREQLRADLLREREAREHLEKVVKELQEQLWPRARPEAAGSEGAAELEP ski-fam89b-1 1362397 n/a 1362402 unspecified role unspecified role prey prey n/a 1362403 unspecified role unspecified role bait bait physical association physical association false false false 1B and D fam89b-ski 1362397 n/a 1362403 unspecified role unspecified role prey prey n/a 1362402 unspecified role unspecified role bait bait physical association physical association false false false 2A and C ski-fam89b-2 1362398 n/a 1362402 unspecified role unspecified role prey prey n/a 1362403 unspecified role unspecified role bait bait physical association physical association false false false no figure fam89b-ski-2 1362399 n/a 1362402 unspecified role unspecified role bait bait n/a 1362403 unspecified role unspecified role prey prey physical association physical association false false false 3A fam89b-ski-3 1362400 n/a 1362402 unspecified role unspecified role bait bait n/a 1362403 unspecified role unspecified role prey prey physical association physical association false false false 3B fam89b-ski-5 1362401 n/a 1362403 unspecified role unspecified role neutral component neutral component n/a 1362402 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 3B