UniProt UniProt http://www.uniprot.org akey-2002-2 The inherited blindness associated protein AIPL1 interacts with the cell cycle regulator protein NUB1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Akey D.T., Zhu X., Dyer M., Li A., Sorensen A., Blackshaw S., Fukuda-Kamitani T., Daiger S.P., Craft C.M., Kamitani T., Sohocki M.M. ms2241@columbia.edu Hum. Mol. Genet. (0964-6906) 2002 Only protein-protein interactions imex curation akey-2002-1 The inherited blindness associated protein AIPL1 interacts with the cell cycle regulator protein NUB1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Akey D.T., Zhu X., Dyer M., Li A., Sorensen A., Blackshaw S., Fukuda-Kamitani T., Daiger S.P., Craft C.M., Kamitani T., Sohocki M.M. ms2241@columbia.edu Hum. Mol. Genet. (0964-6906) 2002 Only protein-protein interactions imex curation akey-2002-3 The inherited blindness associated protein AIPL1 interacts with the cell cycle regulator protein NUB1. chlae-cos_6 African green monkey kidney cell line Grivet cos_6 African green monkey kidney cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Akey D.T., Zhu X., Dyer M., Li A., Sorensen A., Blackshaw S., Fukuda-Kamitani T., Daiger S.P., Craft C.M., Kamitani T., Sohocki M.M. ms2241@columbia.edu Hum. Mol. Genet. (0964-6906) 2002 Only protein-protein interactions imex curation akey-2002-4 The inherited blindness associated protein AIPL1 interacts with the cell cycle regulator protein NUB1. human-y7 Homo sapiens Y7 retinoblastoma cells y7 Y7 retinoblastoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Akey D.T., Zhu X., Dyer M., Li A., Sorensen A., Blackshaw S., Fukuda-Kamitani T., Daiger S.P., Craft C.M., Kamitani T., Sohocki M.M. ms2241@columbia.edu Hum. Mol. Genet. (0964-6906) 2002 Only protein-protein interactions imex curation nub1_bovin NEDD8 ultimate buster 1 NUB1 Negative regulator of ubiquitin-like proteins 1 protein protein bovin Bos taurus (Bovine) Bovine LGLRACDGNVDHAAVHIANRREELDQIKKEEREKKKRRLENINHLKGMGYSMRAARQALHQAAGNLEEALKILLHNPQLWWLNDSAPESNNRQQSPSQEKIDQLVYMGFDAVAAKAALRVFRDNVQLAAQTLVHNGGRLPPDLQLSAEDSSSTPSTSPSDSAGTSSASTDEDMETEAVNEILEDIPEHEEDYLDSTLEDEEIIIAEYLSYVENIKSAAKKN aipl1_bovin Aryl-hydrocarbon-interacting protein-like 1 AIPL1 protein protein bovin Bos taurus (Bovine) Bovine MDATLLLNVEGIKKTILHGGTGDLPNFITGARVTFHFRTMKCDEERTVIDDSKQVGHPMHIIIGNMFKLEVWEILLTSMRVSEVAEFWCDTIHTGVYPILSRSLRQMAEGKDPTEWHVHTCGLANMFAYHTLGYEDLDELQKEPQPLIFIIELLQVEAPSQYQRETWNLNNQEKMQAVPILHGEGNRLFKLGRYEEASNKYQEAIVCLRNLQTKEKPWEVQWLKLEKMINTLILNYCQCLLKKEEYYEVLEHTSDILRHHPGIVKAYYVRARAHAEVWNEAEAKADLEKVLELEPSMRKAVQRELRLLENRLEEKREEERLRCRNMLG aipl1_human Aryl-hydrocarbon-interacting protein-like 1 AIPL1 AIPL2 protein protein human Homo sapiens Human MDAALLLNVEGVKKTILHGGTGELPNFITGSRVIFHFRTMKCDEERTVIDDSRQVGQPMHIIIGNMFKLEVWEILLTSMRVHEVAEFWCDTIHTGVYPILSRSLRQMAQGKDPTEWHVHTCGLANMFAYHTLGYEDLDELQKEPQPLVFVIELLQVDAPSDYQRETWNLSNHEKMKAVPVLHGEGNRLFKLGRYEEASSKYQEAIICLRNLQTKEKPWEVQWLKLEKMINTLILNYCQCLLKKEEYYEVLEHTSDILRHHPGIVKAYYVRARAHAEVWNEAEAKADLQKVLELEPSMQKAVRRELRLLENRMAEKQEEERLRCRNMLSQGATQPPAEPPTEPPAQSSTEPPAEPPTAPSAELSAGPPAEPATEPPPSPGHSLQH nub1_human NEDD8 ultimate buster 1 NUB1 NYREN18 Negative regulator of ubiquitin-like proteins 1 Renal carcinoma antigen NY-REN-18 protein protein human Homo sapiens Human MAQKKYLQAKLTQFLREDRIQLWKPPYTDENKKVGLALKDLAKQYSDRLECCENEVEKVIEEIRCKAIERGTGNDNYRTTGIATIEVFLPPRLKKDRKNLLETRLHITGRELRSKIAETFGLQENYIKIVINKKQLQLGKTLEEQGVAHNVKAMVLELKQSEEDARKNFQLEEEEQNEAKLKEKQIQRTKRGLEILAKRAAETVVDPEMTPYLDIANQTGRSIRIPPSERKALMLAMGYHEKGRAFLKRKEYGIALPCLLDADKYFCECCRELLDTVDNYAVLQLDIVWCYFRLEQLECLDDAEKKLNLAQKCFKNCYGENHQRLVHIKGNCGKEKVLFLRLYLLQGIRNYHSGNDVEAYEYLNKARQLFKELYIDPSKVDNLLQLGFTAQEARLGLRACDGNVDHAATHITNRREELAQIRKEEKEKKRRRLENIRFLKGMGYSTHAAQQVLHAASGNLDEALKILLSNPQMWWLNDSNPETDNRQESPSQENIDRLVYMGFDALVAEAALRVFRGNVQLAAQTLAHNGGSLPPELPLSPEDSLSPPATSPSDSAGTSSASTDEDMETEAVNEILEDIPEHEEDYLDSTLEDEEIIIAEYLSYVENRKSATKKN nub1_chlae_protein Green monkey NUB1 protein protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey Similar to human NUB1 UniProt Ac Q9Y5A7 aipl1-nub1-1 1374084 n/a 1374088 unspecified role unspecified role prey prey n/a 1374089 unspecified role unspecified role bait bait physical association physical association false false false 1 nub1-aipl1 1374084 n/a 1374090 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q9NZN9:p.Arg53Trp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q9NZN9:p.Gly262Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q9NZN9:p.Met79Thr mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q9NZN9:p.Val96Ile mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q9NZN9:p.Arg302Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false A trp278x mutation inducing a premature stop codon was used. n/a 1374091 unspecified role unspecified role bait bait physical association physical association false false false 2 aipl1-nub1 1374085 n/a 1374089 unspecified role unspecified role bait bait n/a 1374088 unspecified role unspecified role prey prey physical association physical association false false false no figure aipl1-nub1_chlae_pro 1374086 n/a 1374092 unspecified role unspecified role prey prey n/a 1374090 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3 aipl1-nub1-2 1374087 n/a 1374091 unspecified role unspecified role prey prey n/a 1374090 unspecified role unspecified role bait bait physical association physical association false false false 4