UniProt UniProt http://www.uniprot.org filipek-2002-2 CacyBP/SIP, a calcyclin and Siah-1-interacting protein, binds EF-hand proteins of the S100 family. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Filipek A., Jastrzebska B., Nowotny M., Kuznicki J. Origin of CACYBP according pmid 10884380, of S100A1 and S100B accord. supplier (Sigma), of S100A6 accord. pimd 7584597, of S100P accord. pmid 1633809 (V. Gerke).Origin of S100A12 cannot be traced and respective interactions have been omitted. anfil@nencki.gov.pl J. Biol. Chem. (0021-9258) 2002 mimix curation filipek-2002-3 CacyBP/SIP, a calcyclin and Siah-1-interacting protein, binds EF-hand proteins of the S100 family. in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom weight identificat confirmation by molecular weight weight identificat Filipek A., Jastrzebska B., Nowotny M., Kuznicki J. Origin of CACYBP according pmid 10884380, of S100A1 and S100B accord. supplier (Sigma), of S100A6 accord. pimd 7584597, of S100P accord. pmid 1633809 (V. Gerke).Origin of S100A12 cannot be traced and respective interactions have been omitted. anfil@nencki.gov.pl J. Biol. Chem. (0021-9258) 2002 mimix curation filipek-2002-5 CacyBP/SIP, a calcyclin and Siah-1-interacting protein, binds EF-hand proteins of the S100 family. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Filipek A., Jastrzebska B., Nowotny M., Kuznicki J. Origin of CACYBP according pmid 10884380, of S100A1 and S100B accord. supplier (Sigma), of S100A6 accord. pimd 7584597, of S100P accord. pmid 1633809 (V. Gerke).Origin of S100A12 cannot be traced and respective interactions have been omitted. anfil@nencki.gov.pl J. Biol. Chem. (0021-9258) 2002 mimix curation filipek-2002-4 CacyBP/SIP, a calcyclin and Siah-1-interacting protein, binds EF-hand proteins of the S100 family. in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Filipek A., Jastrzebska B., Nowotny M., Kuznicki J. Origin of CACYBP according pmid 10884380, of S100A1 and S100B accord. supplier (Sigma), of S100A6 accord. pimd 7584597, of S100P accord. pmid 1633809 (V. Gerke).Origin of S100A12 cannot be traced and respective interactions have been omitted. anfil@nencki.gov.pl J. Biol. Chem. (0021-9258) 2002 mimix curation filipek-2002-1 CacyBP/SIP, a calcyclin and Siah-1-interacting protein, binds EF-hand proteins of the S100 family. rat-brain Rattus norvegicus brain brain Brain [cerebrum] affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Filipek A., Jastrzebska B., Nowotny M., Kuznicki J. Origin of CACYBP according pmid 10884380, of S100A1 and S100B accord. supplier (Sigma), of S100A6 accord. pimd 7584597, of S100P accord. pmid 1633809 (V. Gerke).Origin of S100A12 cannot be traced and respective interactions have been omitted. anfil@nencki.gov.pl J. Biol. Chem. (0021-9258) 2002 mimix curation filipek-2002-6 CacyBP/SIP, a calcyclin and Siah-1-interacting protein, binds EF-hand proteins of the S100 family. mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Filipek A., Jastrzebska B., Nowotny M., Kuznicki J. The host species and tissue has been tentatively assigned to mouse brain, details are not provided in the publication. Origin of CACYBP according pmid 10884380, of S100A1 and S100B accord. supplier (Sigma), of S100A6 accord. pimd 7584597, of S100P accord. pmid 1633809 (V. Gerke).Origin of S100A12 cannot be traced and respective interactions have been omitted. anfil@nencki.gov.pl J. Biol. Chem. (0021-9258) 2002 mimix curation filipek-2002-7 CacyBP/SIP, a calcyclin and Siah-1-interacting protein, binds EF-hand proteins of the S100 family. mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Filipek A., Jastrzebska B., Nowotny M., Kuznicki J. Origin of CACYBP according pmid 10884380, of S100A1 and S100B accord. supplier (Sigma), of S100A6 accord. pimd 7584597, of S100P accord. pmid 1633809 (V. Gerke).Origin of S100A12 cannot be traced and respective interactions have been omitted. anfil@nencki.gov.pl J. Biol. Chem. (0021-9258) 2002 mimix curation cybp_mouse Calcyclin-binding protein Siah-interacting protein Cacybp Sip protein protein mouse Mus musculus Mouse MASVLEELQKDLEEVKVLLEKSTRKRLRDTLTSEKSKIETELKNKMQQKSQKKPELDNEKPAAVVAPLTTGYTVKISNYGWDQSDKFVKIYITLTGVHQVPTENVQVHFTERSFDLLVKNLNGKNYSMIVNNLLKPISVESSSKKVKTDTVIILCRKKAENTRWDYLTQVEKECKEKEKPSYDTEADPSEGLMNVLKKIYEDGDDDMKRTINKAWVESREKQAREDTEF s10a1_bovin Protein S100-A1 S100A1 S-100 protein alpha chain S-100 protein subunit alpha S100 calcium-binding protein A1 protein protein bovin Bos taurus (Bovine) Bovine MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDADAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS s10a6_mouse Protein S100-A6 S100a6 Cacy 5B10 Calcyclin Prolactin receptor-associated protein S100 calcium-binding protein A6 protein protein mouse Mus musculus Mouse MACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMDDLDRNKDQEVNFQEYVAFLGALALIYNEALK s100b_bovin Protein S100-B S100B S100 calcium-binding protein B S-100 protein subunit beta S-100 protein beta chain protein protein bovin Bos taurus (Bovine) Bovine MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEHE s100p_human Protein S100-P S100 calcium-binding protein P S100P S100E Protein S100-E Migration-inducing gene 9 protein protein protein human Homo sapiens Human MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK s100b_rat Protein S100-B S100b S100 calcium-binding protein B S-100 protein subunit beta S-100 protein beta chain protein protein rat Rattus norvegicus (Rat) Rat MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE s100b_mouse Protein S100-B S100b S-100 protein beta chain S-100 protein subunit beta S100 calcium-binding protein B protein protein mouse Mus musculus Mouse MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVAMVTTACHEFFEHE cacybp-s100a1 1354194 n/a 1354201 unspecified role unspecified role bait bait n/a 1354202 unspecified role unspecified role prey prey direct interaction direct interaction false false false 2 cacybp-s100a6 1354194 n/a 1354201 unspecified role unspecified role bait bait n/a 1354203 unspecified role unspecified role prey prey direct interaction direct interaction false false false 2 cacybp-s100b 1354194 n/a 1354201 unspecified role unspecified role bait bait n/a 1354204 unspecified role unspecified role prey prey direct interaction direct interaction false false false 2 cacybp-s100p 1354194 n/a 1354205 unspecified role unspecified role prey prey n/a 1354201 unspecified role unspecified role bait bait direct interaction direct interaction false false false 2 cacybp-cacybp-3 1354195 n/a 1354203 unspecified role unspecified role prey prey n/a 1354201 unspecified role unspecified role bait bait direct interaction direct interaction false false false 3 cacybp-cacybp-2 1354195 n/a 1354202 unspecified role unspecified role prey prey n/a 1354201 unspecified role unspecified role bait bait direct interaction direct interaction false false false 3 cacybp-cacybp-4 1354195 n/a 1354201 unspecified role unspecified role bait bait n/a 1354204 unspecified role unspecified role prey prey direct interaction direct interaction false false false 3 cacybp-cacybp-1 1354195 n/a 1354201 unspecified role unspecified role bait bait n/a 1354205 unspecified role unspecified role prey prey direct interaction direct interaction false false false 3 cacybp-cacybp-7 1354196 n/a 1354201 unspecified role unspecified role bait bait n/a 1354202 unspecified role unspecified role prey prey direct interaction direct interaction false false false 5A cacybp-cacybp-8 1354196 n/a 1354201 unspecified role unspecified role bait bait n/a 1354203 unspecified role unspecified role prey prey direct interaction direct interaction false false false 5A cacybp-cacybp-9 1354196 n/a 1354201 unspecified role unspecified role bait bait n/a 1354204 unspecified role unspecified role prey prey direct interaction direct interaction false false false 5A cacybp-cacybp-6 1354197 n/a 1354202 unspecified role unspecified role neutral component neutral component n/a 1354201 unspecified role unspecified role neutral component neutral component direct interaction direct interaction false false false 4 cacybp-cacybp-5 1354197 n/a 1354204 unspecified role unspecified role neutral component neutral component n/a 1354201 unspecified role unspecified role neutral component neutral component direct interaction direct interaction false false false 4 cacybp-cacybp 1354198 n/a 1354201 unspecified role unspecified role bait bait n/a 1354206 unspecified role unspecified role prey prey physical association physical association false false false 1 s100b-s100b-5 1354199 n/a 1354201 unspecified role unspecified role prey prey n/a 1354207 unspecified role unspecified role bait bait physical association physical association false false false 5B s100a6-cacybp-1 1354200 n/a 1354201 unspecified role unspecified role prey prey n/a 1354203 unspecified role unspecified role bait bait physical association physical association false false false 5B