IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ boehm-2001-1 Regulation of BOB.1/OBF.1 stability by SIAH. baker's yeast-hf7 Saccharomyces cerevisiae baker's yeast-hf7 Saccharomyces cerevisiae 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Boehm J., He Y., Greiner A., Staudt L., Wirth T. The BOB.1/OBF.1 construct used in this experiment has been entered as of Murine origin based on previous work by the last author, such as PMID:10671201. thomas.wirth@medizin.uni-ulm.de Jurkat T cell library EMBO J. (0261-4189) 2001 Only protein-protein interactions imex curation boehm-2001-3 Regulation of BOB.1/OBF.1 stability by SIAH. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Boehm J., He Y., Greiner A., Staudt L., Wirth T. The BOB.1/OBF.1 construct used in this experiment has been entered as of Murine origin based on previous work by the last author, such as PMID:10671201. thomas.wirth@medizin.uni-ulm.de Jurkat T cell library EMBO J. (0261-4189) 2001 Only protein-protein interactions imex curation boehm-2001-2 Regulation of BOB.1/OBF.1 stability by SIAH. in vitro In vitro pull down pull down autoradiography autoradiography Boehm J., He Y., Greiner A., Staudt L., Wirth T. The BOB.1/OBF.1 construct used in this experiment has been entered as of Murine origin based on previous work by the last author, such as PMID:10671201. thomas.wirth@medizin.uni-ulm.de Jurkat T cell library EMBO J. (0261-4189) 2001 Only protein-protein interactions imex curation boehm-2001-4 Regulation of BOB.1/OBF.1 stability by SIAH. mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells gal4 vp16 complement gal4 vp16 complementation karyoplasmic interaction ion strategy KISS mammalian two hybrid gal4 vp16 complement predetermined predetermined participant predetermined Boehm J., He Y., Greiner A., Staudt L., Wirth T. The BOB.1/OBF.1 construct used in this experiment has been entered as of Murine origin based on previous work by the last author, such as PMID:10671201. thomas.wirth@medizin.uni-ulm.de Jurkat T cell library EMBO J. (0261-4189) 2001 Only protein-protein interactions imex curation boehm-2001-5 Regulation of BOB.1/OBF.1 stability by SIAH. baker's yeast-hf7 Saccharomyces cerevisiae baker's yeast-hf7 Saccharomyces cerevisiae 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Boehm J., He Y., Greiner A., Staudt L., Wirth T. The BOB.1/OBF.1 construct used in this experiment has been entered as of Murine origin based on previous work by the last author, such as PMID:10671201. thomas.wirth@medizin.uni-ulm.de Jurkat T cell library EMBO J. (0261-4189) 2001 Only protein-protein interactions imex curation boehm-2001-7 Regulation of BOB.1/OBF.1 stability by SIAH. baker's yeast-hf7 Saccharomyces cerevisiae baker's yeast-hf7 Saccharomyces cerevisiae 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Boehm J., He Y., Greiner A., Staudt L., Wirth T. The BOB.1/OBF.1 construct used in this experiment has been entered as of Murine origin based on previous work by the last author, such as PMID:10671201. thomas.wirth@medizin.uni-ulm.de Jurkat T cell library EMBO J. (0261-4189) 2001 Only protein-protein interactions imex curation obf1_mouse POU domain class 2-associating factor 1 Pou2af1 Obf-1 B-cell-specific coactivator OBF-1 OCT-binding factor 1 BOB-1 OCA-B protein protein mouse Mus musculus Mouse MLWQKSTAPEQAPAPPRPYQGVRVKEPVKELLRRKRGHTSVGAAGPPTAVVLPHQPLATYSTVGPSCLDMEVSASTVTEEGTLCAGWLSQPAPATLQPLAPWTPYTEYVSHEAVSCPYSTDMYVQPVCPSYTVVGPSSVLTYASPPLITNVTPRSTATPAVGPQLEGPEHQAPLTYFPWPQPLSTLPTSSLQYQPPAPTLSGPQFVQLPISIPEPVLQDMDDPRRAISSLTIDKLLLEEEESNTYELNHTLSVEGF siah1_human E3 ubiquitin-protein ligase SIAH1 Seven in absentia homolog 1 Siah-1a SIAH1 HUMSIAH RING-type E3 ubiquitin transferase SIAH1 protein protein human Homo sapiens Human MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC siah2_human E3 ubiquitin-protein ligase SIAH2 Seven in absentia homolog 2 SIAH2 RING-type E3 ubiquitin transferase SIAH2 protein protein human Homo sapiens Human MSRPSSTGPSANKPCSKQPPPQPQHTPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGGGGGAGPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCP obf1_human POU domain class 2-associating factor 1 POU2AF1 OBF1 B-cell-specific coactivator OBF-1 OCT-binding factor 1 BOB-1 OCA-B BOB1 protein protein human Homo sapiens Human MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEGF pou2af1-siah1 1451550 n/a 1451556 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1451557 unspecified role unspecified role prey prey physical association physical association false false false Fig. 2a pou2af1-siah2 1451550 n/a 1451556 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1451558 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 2a siah1-pou2af1-1 1451551 n/a 1451557 unspecified role unspecified role bait bait seven-in-absentia protein, traf-like domain required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false escherichia coli dh5[alpha] escherichia coli dh5[alpha] n/a 1451556 unspecified role unspecified role prey prey mouse-s194 Mus musculus s194 mouse B-lymphocyte myeloma/plasmacytoma cell line physical association physical association false false false Fig. 3b siah1-pou2af1-4 1451551 n/a 1451557 unspecified role unspecified role bait bait seven-in-absentia protein, traf-like domain required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false escherichia coli dh5[alpha] escherichia coli dh5[alpha] n/a 1451559 unspecified role unspecified role prey prey human-b-cell Homo sapiens B cell b-cell B-cell [B lymphocyte; B-lymphocyte; B cell; B-cells] physical association physical association false false false Fig. 8d siah1-pou2af1 1451552 n/a 1451556 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 1451557 unspecified role unspecified role bait bait seven-in-absentia protein, traf-like domain required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false escherichia coli dh5[alpha] escherichia coli dh5[alpha] 1451582 1451579 direct interaction direct interaction false false false Fig. 3a Q8IUQ4 increases degradation of protein levels of Q64693 Q8IUQ4 decreases activity of Q64693 siah1-pou2af1-2 1451553 n/a 1451557 unspecified role unspecified role bait bait seven-in-absentia protein, traf-like domain required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 1451556 unspecified role unspecified role prey prey physical association physical association false false false Fig. 3c siah1-pou2af1-3 1451554 n/a 1451557 unspecified role unspecified role bait bait n/a 1451559 unspecified role unspecified role prey prey Q16633:p.Val51Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 6a, Fig. 6b pou2af1-siah1-2 1451555 n/a 1451556 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1451557 unspecified role unspecified role prey prey seven-in-absentia protein, traf-like domain required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 2b