UniProt UniProt http://www.uniprot.org pr_v_t-2001-1 Relationships of the antiproliferative proteins BTG1 and BTG2 with CAF1, the human homolog of a component of the yeast CCR4 transcriptional complex: involvement in estrogen receptor alpha signaling pathway. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Prévôt D., Morel A.P., Voeltzel T., Rostan M.C., Rimokh R., Magaud J.P., Corbo L. Origin of BTG1 and BTG2 according Ref. 17, pmid 9712883 (same lab). Exp fig 7 (far western blotting) omitted as origin of ERalpha cannot be established from the publication. corbo@lyon.fnclcc.fr J. Biol. Chem. (0021-9258) 2001 mimix curation pr_v_t-2001-2 Relationships of the antiproliferative proteins BTG1 and BTG2 with CAF1, the human homolog of a component of the yeast CCR4 transcriptional complex: involvement in estrogen receptor alpha signaling pathway. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Prévôt D., Morel A.P., Voeltzel T., Rostan M.C., Rimokh R., Magaud J.P., Corbo L. Origin of BTG1 and BTG2 according Ref. 17, pmid 9712883 (same lab). Exp fig 7 (far western blotting) omitted as origin of ERalpha cannot be established from the publication. corbo@lyon.fnclcc.fr J. Biol. Chem. (0021-9258) 2001 mimix curation cnot8_human CCR4-NOT transcription complex subunit 8 CNOT8 CALIF POP2 CCR4-associated factor 8 CAF1-like protein CAF2 Caf1b protein protein human Homo sapiens Human MPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSGLQFQKHEEEGIDTLHFAELLMTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLPEEEHEFFHILNLFFPSIYDVKYLMKSCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ btg1_human Protein BTG1 BTG1 B-cell translocation gene 1 protein protein protein human Homo sapiens Human MHPFYTRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEKPCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGSICVLYEASPAGGSTQNSTNVQMVDSRISCKEELLLGRTSPSKNYNMMTVSG btg2_human Protein BTG2 BTG family member 2 NGF-inducible anti-proliferative protein PC3 BTG2 PC3 protein protein human Homo sapiens Human MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLGRSSPSKNYVMAVSS cnot7_human CCR4-NOT transcription complex subunit 7 CNOT7 CAF1 CCR4-associated factor 1 BTG1-binding factor 1 Caf1a protein protein human Homo sapiens Human MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS cnot8-btg1 1374724 n/a 1374726 unspecified role unspecified role bait bait n/a 1374727 unspecified role unspecified role prey prey physical association physical association false false false 2A cnot8-btg2 1374724 n/a 1374728 unspecified role unspecified role prey prey n/a 1374726 unspecified role unspecified role bait bait physical association physical association false false false 2A btg1-cnot7-4 1374724 n/a 1374729 unspecified role unspecified role prey prey n/a 1374727 unspecified role unspecified role bait bait physical association physical association false false false 3A btg2-cnot7-3 1374724 n/a 1374729 unspecified role unspecified role prey prey n/a 1374728 unspecified role unspecified role bait bait physical association physical association false false false 4B btg1-cnot8-1 1374725 n/a 1374727 unspecified role unspecified role bait bait n/a 1374726 unspecified role unspecified role prey prey physical association physical association false false false 2B btg2-cnot8 1374725 n/a 1374728 unspecified role unspecified role bait bait n/a 1374726 unspecified role unspecified role prey prey physical association physical association false false false 2B cnot7-btg1 1374725 n/a 1374729 unspecified role unspecified role bait bait n/a 1374727 unspecified role unspecified role prey prey physical association physical association false false false 3D and 8 btg2-cnot7-5 1374725 n/a 1374729 unspecified role unspecified role prey prey n/a 1374728 unspecified role unspecified role bait bait physical association physical association false false false 4D