UniProt UniProt http://www.uniprot.org cho-2000a-2 RBT1, a novel transcriptional co-activator, binds the second subunit of replication protein A. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Cho J.M., Song D.J., Bergeron J., Benlimame N., Wold M.S., Alaoui-Jamali M.A. Did not report all possible interactions since some proteins might have transactivation activity and negative controls are not provided for instance for RPA3. mdaj@musica.mcgill.ca Nucleic Acids Res. (0305-1048) 2000 mimix curation cho-2000a-3 RBT1, a novel transcriptional co-activator, binds the second subunit of replication protein A. in vitro In vitro pull down pull down autoradiography autoradiography Cho J.M., Song D.J., Bergeron J., Benlimame N., Wold M.S., Alaoui-Jamali M.A. All constructs are described in MandM or text and are of human origin mdaj@musica.mcgill.ca Nucleic Acids Res. (0305-1048) 2000 mimix curation cho-2000a-1 RBT1, a novel transcriptional co-activator, binds the second subunit of replication protein A. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Cho J.M., Song D.J., Bergeron J., Benlimame N., Wold M.S., Alaoui-Jamali M.A. mdaj@musica.mcgill.ca Human osteosarcoma Nucleic Acids Res. (0305-1048) 2000 mimix curation cho-2000a-4 RBT1, a novel transcriptional co-activator, binds the second subunit of replication protein A. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip monoclonal western monoclonal antibody western blot monoclonal western Cho J.M., Song D.J., Bergeron J., Benlimame N., Wold M.S., Alaoui-Jamali M.A. mdaj@musica.mcgill.ca Nucleic Acids Res. (0305-1048) 2000 mimix curation cho-2000a-5 RBT1, a novel transcriptional co-activator, binds the second subunit of replication protein A. human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Cho J.M., Song D.J., Bergeron J., Benlimame N., Wold M.S., Alaoui-Jamali M.A. mdaj@musica.mcgill.ca Nucleic Acids Res. (0305-1048) 2000 mimix curation rfa2_human Replication protein A 32 kDa subunit RPA34 Replication protein A 34 kDa subunit Replication factor A protein 2 RPA2 REPA2 RPA32 protein protein human Homo sapiens Human MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE srtd3_human SERTA domain-containing protein 3 Replication protein-binding trans-activator SERTAD3 RBT1 protein protein human Homo sapiens Human MVGGLKRKHSDLEEEEERWEWSPAGLQSYQQALLRISLDKVQRSLGPRAPSLRRHVLIHNTLQQLQAALRLAPAPALPPEPLFLGEEDFSLSATIGSILRELDTSMDGTEPPQNPVTPLGLQNEVPPQPDPVFLEALSSRYLGDSGLDDFFLDIDTSAVEKEPARAPPEPPHNLFCAPGSWEWNELDHIMEIILGS rfa3_human Replication protein A 14 kDa subunit Replication factor A protein 3 RPA3 REPA3 RPA14 protein protein human Homo sapiens Human MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD xpa_human DNA repair protein complementing XP-A cells XPA XPAC Xeroderma pigmentosum group A-complementing protein protein protein human Homo sapiens Human MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM ung_human Uracil-DNA glycosylase UNG DGU UNG15 UNG1 protein protein human Homo sapiens Human MIGQKTLYSFFSPSPARKRHAPSPEPAVQGTGVAGVPEESGDAAAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL rpa2-sertad3-1 1469497 n/a 1469502 unspecified role unspecified role bait bait n/a 1469503 unspecified role unspecified role prey prey physical association physical association false false false table 1 and fig 6 rpa3-rpa2-1 1469497 n/a 1469504 unspecified role unspecified role bait bait n/a 1469502 unspecified role unspecified role prey prey physical association physical association false false false table 1 rpa2-xpa 1469497 n/a 1469502 unspecified role unspecified role bait bait n/a 1469505 unspecified role unspecified role prey prey physical association physical association false false false table 1 and fig 6 rpa2-ung 1469497 n/a 1469502 unspecified role unspecified role bait bait n/a 1469506 unspecified role unspecified role prey prey physical association physical association false false false table 1 and fig 6 ung-rpa2 1469497 n/a 1469502 unspecified role unspecified role prey prey n/a 1469506 unspecified role unspecified role bait bait physical association physical association false false false table 1 and fig 6 rpa2-rpa3-3 1469497 n/a 1469502 unspecified role unspecified role bait bait n/a 1469504 unspecified role unspecified role prey prey physical association physical association false false false table 1 sertad3-rpa2 1469498 n/a 1469502 unspecified role unspecified role prey prey n/a 1469503 unspecified role unspecified role bait bait physical association physical association false false false fig 2 rpa3-rpa2 1469498 n/a 1469502 unspecified role unspecified role prey prey n/a 1469504 unspecified role unspecified role bait bait physical association physical association false false false fig 2 rpa2-sertad3 1469499 n/a 1469502 unspecified role unspecified role bait bait n/a 1469503 unspecified role unspecified role prey prey physical association physical association false false false results text sertad3-rpa2-1 1469500 n/a 1469502 unspecified role unspecified role prey prey n/a 1469503 unspecified role unspecified role bait bait physical association physical association false false false fig 3 rpa2-sertad3-3 1469501 n/a 1469502 unspecified role unspecified role neutral component neutral component n/a 1469503 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false fig 5