mbinfo MBInfo http://www.mechanobio.info/ http://www.mechanobio.info/ miki-1998-2 Induction of filopodium formation by a WASP-related actin-depolymerizing protein N-WASP. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting autoradiography autoradiography Miki H., Sasaki T., Takai Y., Takenawa T. Interactions from figures 2b, 2c and 4c could not be curated since the source of GST-N-WASP and His-WASP was not specified by the author or could not be traced from references. Interaction detection method: GST pull down. The source of Cdc42 traced from references and the source of N-WASP (endogenous) inferred from the cell lysates (rat brain) used. takenawa@hgc.ims. u-tokyo.ac.jp Nature (0028-0836) 1998 Only protein-protein interactions imex curation miki-1998-1 Induction of filopodium formation by a WASP-related actin-depolymerizing protein N-WASP. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Miki H., Sasaki T., Takai Y., Takenawa T. Interactions from figures 2b, 2c and 4c could not be curated since the source of GST-N-WASP and His-WASP was not specified by the author or could not be traced from references. Interaction detection method: GST pull down. The source of Cdc42 traced from references and the source of N-WASP (endogenous) inferred from the cell lysates (rat brain) used. takenawa@hgc.ims. u-tokyo.ac.jp Nature (0028-0836) 1998 Only protein-protein interactions imex curation miki-1998-3 Induction of filopodium formation by a WASP-related actin-depolymerizing protein N-WASP. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Miki H., Sasaki T., Takai Y., Takenawa T. Interactions from figures 2b, 2c and 4c could not be curated since the source of GST-N-WASP and His-WASP was not specified by the author or could not be traced from references. Interaction detection method: GST pull down. The source of Cdc42 traced from references and the source of N-WASP (endogenous) inferred from the cell lysates (rat brain) used. takenawa@hgc.ims. u-tokyo.ac.jp Nature (0028-0836) 1998 Only protein-protein interactions imex curation wasl_rat Neural Wiskott-Aldrich syndrome protein Wasl protein protein rat Rattus norvegicus (Rat) Rat MSSGQQPPRRVTNVGSLLLTPQENESLFSFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDAPNGPNLPMATVDIKNPEITTNRFYSSQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHSSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPGVVVPPPPPNRMYPPPPPALPSSAPSGPPPPPPLSMAGSTAPPPPPPPPPPPGPPPPPGLPSDGDHQVPASSGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQESTPPTPAPTSGIVGALMEVMQKRSKAIHSSDEDEDDDDEEDFQDDDEWED cdc42_human Cell division control protein 42 homolog CDC42 G25K GTP-binding protein protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL wasp_human Wiskott-Aldrich syndrome protein WAS IMD2 protein protein human Homo sapiens Human MSGGPMGGRPGGRGAPAVQQNIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPGAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADEDEAQAFRALVQEKIQKRNQRQSGDRRQLPPPPTPANEERRGGLPPLPLHPGGDQGGPPVGPLSLGLATVDIQNPDITSSRYRGLPAPGPSPADKKRSGKKKISKADIGAPSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVRQEMRRQEPLPPPPPPSRGGNQLPRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALVPAGGLAPGGGRGALLDQIRQGIQLNKTPGAPESSALQPPPQSSEGLVGALMHVMQKRSRAIHSSDEGEDQAGDEDEDDEWDD cdc42-wasl-3 1295652 n/a 1295655 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false gbd/crib domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false O08816:p.His208Asp mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1295656 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 2b. cdc42-was-4 1295652 n/a 1295656 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P60953:p.Tyr40Cys mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1295657 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false gbd/crib domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig 2c. cdc42-wasl-2 1295653 n/a 1295656 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1295655 unspecified role unspecified role bait bait rat-brain Rattus norvegicus brain brain Brain [cerebrum] physical association physical association false false false Fig 2a. N-WASP interacts with only GTP-bound Cdc42 and the interaction is abolished when Cdc42 is GDP-bound. wasl-wasl-1 1295654 n/a 1295655 unspecified role unspecified role prey prey gbd/crib domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1295655 unspecified role unspecified role bait bait vca domain sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 1295683 1295680 direct interaction direct interaction false false false Fig 4c.