UniProt UniProt http://www.uniprot.org de-1997-1 A20 inhibits NF-kappaB activation independently of binding to 14-3-3 proteins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence De Valck D., Heyninck K., Van Criekinge W., Vandenabeele P., Fiers W., Beyaert R. rudi@lmb1.rug.ac.be L929r2 fibrosarcoma cDNA (murine) Biochem. Biophys. Res. Commun. (0006-291X) 1997 Only protein-protein interactions imex curation de-1997-2 A20 inhibits NF-kappaB activation independently of binding to 14-3-3 proteins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined De Valck D., Heyninck K., Van Criekinge W., Vandenabeele P., Fiers W., Beyaert R. rudi@lmb1.rug.ac.be Biochem. Biophys. Res. Commun. (0006-291X) 1997 Only protein-protein interactions imex curation de-1997-3 A20 inhibits NF-kappaB activation independently of binding to 14-3-3 proteins. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot De Valck D., Heyninck K., Van Criekinge W., Vandenabeele P., Fiers W., Beyaert R. rudi@lmb1.rug.ac.be Biochem. Biophys. Res. Commun. (0006-291X) 1997 Only protein-protein interactions imex curation 1433z_mouse 14-3-3 protein zeta/delta Ywhaz Protein kinase C inhibitor protein 1 SEZ-2 protein protein mouse Mus musculus Mouse MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN tnap3_human Tumor necrosis factor alpha-induced protein 3 Putative DNA-binding protein A20 Zinc finger protein A20 TNFAIP3 OTUD7C OTU domain-containing protein 7C protein protein human Homo sapiens Human MAEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALIDRNIQATLESQKKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTDLVLRKALFSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWNDEWDNLIKMASTDTPMARSGLQYNSLEEIHIFVLCNILRRPIIVISDKMLRSLESGSNFAPLKVGGIYLPLHWPAQECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVNRDRGRFEDLKVHFLTDPENEMKEKLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKWQENSEQGRREGHAQNPMEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNKLPKLNSKPGPEGLPGMALGASRGEAYEPLAWNPEESTGGPHSAPPTAPSPFLFSETTAMKCRSPGCPFTLNVQHNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTCFKRTTAEASSSLSTSLPPSCHQRSKSDPSRLVRSPSPHSCHRAGNDAPAGCLSQAARTPGDRTGTSKCRKAGCVYFGTPENKGFCTLCFIEYRENKHFAAASGKVSPTASRFQNTIPCLGRECGTLGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRPKCARASCKNILACRSEELCMECQHPNQRMGPGAHRGEPAPEDPPKQRCRAPACDHFGNAKCNGYCNECFQFKQMYG 1433f_mouse 14-3-3 protein eta Ywhah protein protein mouse Mus musculus Mouse MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEHMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN tnfaip3-ywhaz-1 1291438 n/a 1291441 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1291442 unspecified role unspecified role bait bait physical association physical association false false false no figure tnfaip3-ywhah 1291438 n/a 1291443 unspecified role unspecified role prey prey n/a 1291442 unspecified role unspecified role bait bait physical association physical association false false false no figure tnfaip3-ywhah-1 1291439 n/a 1291443 unspecified role unspecified role prey prey n/a 1291442 unspecified role unspecified role bait bait P21580:p.Arg562Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P21580:p.Ser565Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table I and II tnfaip3-ywhaz-2 1291439 n/a 1291441 unspecified role unspecified role prey prey n/a 1291442 unspecified role unspecified role bait bait P21580:p.Arg562Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P21580:p.Ser565Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false no figure tnfaip3-ywhah-2 1291440 n/a 1291442 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection P21580:p.Arg562Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P21580:p.Ser565Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false e-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1291443 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 1