mpidb The Microbial Protein Interaction Database lu-1997a-1 Interactions of the components of the general secretion pathway: role of Pseudomonas aeruginosa type IV pilin subunits in complex formation and extracellular protein secretion. in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Lu H.M., Motley S.T., Lory S. Actual strain used = PAK BS3 cross-linking Mol. Microbiol. (0950-382X) 1997 Only protein-protein interactions imex curation k0xq02_pseai A161_15170 protein protein pseudomonas aeruginosa pao579 Pseudomonas aeruginosa PAO579 MQRRQQSGFTLIEIMVVVVILGILAALVVPQVMSRPDQAKVTVAKGDIKAIAAALDMYKLDNFAYPSTQQGLEALVKKPTGNPQPKNWNKDGYLKKLPVDPWGNPYQYLAPGTKGPFDLYSLGADGKEGGSDNDADIGNWDN The sequence has been withdrawn from uniprot. fmpa_pseai Fimbrial protein pilA fimA Pilin protein protein pseai Pseudomonas aeruginosa MKAQKGFTLIELMIVVAIIGILAAIAIPQYQNYVARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR k1ct21_pseai xcpW PABE177_1638 protein protein pseudomonas aeruginosa atcc 700888 Pseudomonas aeruginosa ATCC 700888 MRLQRGFTLLELLIAIAIFALLALATYRMFDSVMQTDQATRVQEQRMRELVRAMGALERDLTQAVERPVRDELGDNRGAFLSEGENDQIVEFTRGGWRNPLGQARSRLQRVRWSLSGETLERRYWLVLDRAQDSKPRVQQVLDGVTALSWRFLDKEHNWQGHWPTDEGSEEERLESLPLAVEMTLEHRHYGKLVRVWRLLDPPLKQDQPQGQPGGENGENGEGGVPQPPEGMPGAPE The sequence has been withdrawn from uniprot. k1cif5_pseai xcpV PABE171_1896 protein protein pseudomonas aeruginosa atcc 14886 pseudomonas aeruginosa atcc 14886 MKRARGFTLLEVLVALAIFAMVAASVLSASARSLQNASRLEDKTLAMWIADNRLNELQLEQTPPSSGRNQGELEFAGRRWEWRTQVDSTAEQDMRRVIVWVAAKPLGRERGSIEERAAARLVGFLGSQP The sequence has been withdrawn from uniprot. k1dm76_pseai xcpU PABE173_2250 protein protein pseudomonas aeruginosa atcc 25324 Pseudomonas aeruginosa ATCC 25324 MRASRGFTLIELMVVMVIISVLIGLAVLSTGFASTSRELDSEAERLAGLIGVLTDEAVLDNREYGLRLERDAYQVLRYDEAKARWLPVARDSHRLPEWAELTFELDGQPLVLAGSKGEKEQKKGTDQPQLLILSSGELSPFRLRLAERGPEGRALSLSSDGFRLPRVEVARR The sequence has been withdrawn from uniprot. gspg_pseae Type II secretion system core protein G xcpT pddA PA3101 General secretion pathway protein G PilD-dependent protein PddA protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MQRRQQSGFTLIEIMVVVVILGILAALVVPQVMSRPDQAKVTVAKGDIKAIAAALDMYKLDNFAYPSTQQGLEALVKKPTGNPQPKNWNKDGYLKKLPVDPWGNPYQYLAPGTKGPFDLYSLGADGKEGGSDNDADIGNWDN k0xq02-xcpt 1340437 n/a 1340438 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-1118973704 1340439 unspecified role unspecified role prey prey physical association physical association false false false Fig. 7 xcpt-xcpw-2 1340437 n/a 1340440 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1340438 unspecified role unspecified role prey prey physical association physical association false false false Fig. 7 k0xq02-xcpv 1340437 n/a 1340438 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1340441 unspecified role unspecified role prey prey physical association physical association false false false Fig. 7 k0xq02-xcpu 1340437 n/a 1340438 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1340442 unspecified role unspecified role prey prey physical association physical association false false false Fig. 7 xcpu-xcpu 1340437 n/a 1340442 unspecified role unspecified role prey prey n/a 1340442 unspecified role unspecified role bait bait physical association physical association false false false Fig.1 pila-xcpu-1 1340437 n/a 1340442 unspecified role unspecified role prey prey not-defined-514846477 1340439 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4D pila-pila-3 1340437 n/a 1340439 unspecified role unspecified role prey prey not-defined-2044749309 1340439 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4B pila-xcpw 1340437 n/a 1340440 unspecified role unspecified role prey prey not-defined-2044749309 1340439 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4B pila-xcpt-1 1340437 not-defined-1844721368 1340443 unspecified role unspecified role prey prey not-defined-1916384665 1340439 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4A, 4B xcpt-xcpt 1340437 not-defined-1844721368 1340443 unspecified role unspecified role neutral component neutral component n/a 1340443 unspecified role unspecified role neutral component neutral component physical association physical association false false false Fig. 5