IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ reid-1976-1 Isolation, by partial pepsin digestion, of the three collagen-like regions present in subcomponent Clq of the first component of human complement. in vitro In vitro enzymatic footprint enzymatic footprinting enzymatic footprint edman degradation edman degradation Reid K.B. C1q was purified, subject to pepsin degradation, then peptides were separated using a salt gradient over a CM-Sepharose column. Biochem. J. (0264-6021) 1976 Only protein-protein interactions imex curation c1qb_human Complement C1q subcomponent subunit B C1QB protein protein human Homo sapiens Human MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA c1qa_human Complement C1q subcomponent subunit A C1QA protein protein human Homo sapiens Human MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA c1qc_human Complement C1q subcomponent subunit C C1QC C1QG protein protein human Homo sapiens Human MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD c1qa-c1qb-3 1311965 n/a 1311966 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind less-than less-than certain certain sequence position certain false cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain false human-serum Homo sapiens serum Serum Stoichiometry: 1.0 n/a 1311967 unspecified role unspecified role neutral component neutral component cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-serum Homo sapiens serum Serum Stoichiometry: 1.0 1311974 1311972 1311975 1311971 direct interaction direct interaction false false false Figs. 2, 4 c1qc-c1qc 1311965 n/a 1311968 unspecified role unspecified role neutral component neutral component cys-32 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain greater-than greater-than false human-serum Homo sapiens serum Serum Stoichiometry: 1.0 n/a 1311968 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain greater-than greater-than false cys-32 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain false human-serum Homo sapiens serum Serum Stoichiometry: 1.0 1311981 1311979 1311982 1311978 direct interaction direct interaction false false false Figs. 2, 4