MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint mizutani-2012-1 Functional differentiation of structurally similar membrane subunits of the ABC transporter LolCDE complex. in vitro In vitro crosslink cross-linking study crosslink experimental particp experimental participant identification experimental particp Mizutani M., Mukaiyama K., Xiao J., Mori M., Satou R., Narita S., Okuda S., Tokuda H. FEBS Lett. (0014-5793) 2013 mizutani-2012-2 Functional differentiation of structurally similar membrane subunits of the ABC transporter LolCDE complex. ecoli Escherichia coli (strain K12) crosslink cross-linking study crosslink experimental particp experimental participant identification experimental particp Mizutani M., Mukaiyama K., Xiao J., Mori M., Satou R., Narita S., Okuda S., Tokuda H. FEBS Lett. (0014-5793) 2013 mizutani-2013-1 Functional differentiation of structurally similar membrane subunits of the ABC transporter LolCDE complex. in vitro In vitro competition binding competition binding experimental particp experimental participant identification experimental particp Mizutani M., Mukaiyama K., Xiao J., Mori M., Satou R., Narita S., Okuda S., Tokuda H. FEBS Lett. (0014-5793) 2013 lole_ecoli Lipoprotein-releasing system transmembrane protein LolE lolE b1118 JW1104 ycfW protein protein ecoli Escherichia coli (strain K12) MAMPLSLLIGLRFSRGRRRGGMVSLISVISTIGIALGVAVLIVGLSAMNGFERELNNRILAVVPHGEIEAVDQPWTNWQEALDHVQKVPGIAAAAPYINFTGLVESGANLRAIQVKGVNPQQEQRLSALPSFVQGDAWRNFKAGEQQIIIGKGVADALKVKQGDWVSIMIPNSNPEHKLMQPKRVRLHVAGILQLSGQLDHSFAMIPLADAQQYLDMGSSVSGIALKMTDVFNANKLVRDAGEVTNSYVYIKSWIGTYGYMYRDIQMIRAIMYLAMVLVIGVACFNIVSTLVMAVKDKSGDIAVLRTLGAKDGLIRAIFVWYGLLAGLFGSLCGVIIGVVVSLQLTPIIEWIEKLIGHQFLSSDIYFIDFLPSELHWLDVFYVLVTALLLSLLASWYPARRASNIDPARVLSGQ pal_ecoli Peptidoglycan-associated lipoprotein pal excC b0741 JW0731 Tol-Pal system lipoprotein Pal protein protein ecoli Escherichia coli (strain K12) MQLNKVLKGLMIALPVMAIAACSSNKNASNDGSEGMLGAGTGMDANGGNGNMSSEEQARLQMQQLQQNNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY lola_ecoli Outer-membrane lipoprotein carrier protein yzzV P20 lolA lplA b0891 JW0874 protein protein ecoli Escherichia coli (strain K12) MKKIAITCALLSSLVASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK lole-pal 1328051 lole LolE 1328054 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified pal_ecoli Pal 1328055 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false mint f2a f2b f3 f4a pal-1 1328051 pal_ecoli Pal 1328055 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 direct interaction direct interaction false false false f2b mint lole-pal-1 1328052 lole LolE 1328054 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell pal_ecoli Pal 1328055 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f1a f1c mint lola-pal 1328053 pal_ecoli Pal 1328055 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false lola_ecoli LolA 1328056 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified physical association physical association false false false mint f4c f5