MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint mohorko-2012-1 Thioredoxin-like protein TlpA from Bradyrhizobium japonicum is a reductant for the copper metallochaperone ScoI. in vitro In vitro crosslink cross-linking study crosslink experimental particp experimental participant identification experimental particp Mohorko E., Abicht HK., Bühler D., Glockshuber R., Hennecke H., Fischer HM. FEBS Lett. (0014-5793) 2012 mohorko-2012-2 Thioredoxin-like protein TlpA from Bradyrhizobium japonicum is a reductant for the copper metallochaperone ScoI. in vitro In vitro oxidoreduct assay oxidoreductase assay oxidoreduct assay experimental particp experimental participant identification experimental particp Mohorko E., Abicht HK., Bühler D., Glockshuber R., Hennecke H., Fischer HM. FEBS Lett. (0014-5793) 2012 q89vb6_bradu blr1131 protein protein braja Bradyrhizobium japonicum (strain USDA 110) MSSATRPLVIATAFAASLIVGLLIMFWAMGGVGKVAQPAAIGGPFQLTDQNGKAVTDKSLKGKPTLIFFGYTHCPDVCPTSLFEISEVLRAMGKDADKVNAIFISVDPERDTPATMKNYLSSFDPHLEGLSGDPAEIAKVITSYRVYAKKVPTKDGDYTMDHTALIYLMDRDGRFVSPFNLKRTPEEAAADLKRYL mint tlpa_bradu Thiol:disulfide interchange protein TlpA tlpA Cytochrome c biogenesis protein TlpA bll1380 protein protein braja Bradyrhizobium japonicum (strain USDA 110) MLDTKPSATRRIPLVIATVAVGGLAGFAALYGLGLSRAPTGDPACRAAVATAQKIAPLAHGEVAALTMASAPLKLPDLAFEDADGKPKKLSDFRGKTLLVNLWATWCVPCRKEMPALDELQGKLSGPNFEVVAINIDTRDPEKPKTFLKEANLTRLGYFNDQKAKVFQDLKAIGRALGMPTSVLVDPQGCEIATIAGPAEWASEDALKLIRAATGKAAAAL mint q89vb6-tlpa 1322395 blr1131 ScoI 1322397 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified Q89VB6:p.Cys78Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false tlpa TlpA 1322398 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f3 mint q89vb6-tlpa-1 1322395 tlpa TlpA 1322398 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified blr1131 ScoI 1322397 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified Q89VB6:p.Cys74Ser mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f3 mint q89vb6-tlpa-2 1322396 blr1131 ScoI 1322397 predetermined predetermined participant predetermined electron acceptor electron acceptor neutral component neutral component purified purified tlpa TlpA 1322398 predetermined predetermined participant predetermined electron donor electron donor neutral component neutral component purified purified redox reaction oxidoreductase activity electron transfer reaction redox reaction false false false f2b mint