MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint patil-2012-1 Structural basis for dual inhibitory role of tamarind Kunitz inhibitor (TKI) against factor Xa and trypsin. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction experimental particp experimental participant identification experimental particp Patil DN., Chaudhary A., Sharma AK., Tomar S., Kumar P. FEBS J. (1742-464X) 2012 tryp_pig Trypsin protein protein pig Sus scrofa (Pig) Pig FPTDDDDKIVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN mint f4zzg4_tamin protein protein tamarind Tamarindus indica DYTVHDTDGKPVLNNAGQYYILPAKQGKGGGLGLSNDDDGNCPLTVSQTPIDLPIGLPVRFSSRARISHITTALSLNIEFTIAPACAPKPARWRIFDEQSSEKGYTPVKISDDFSSAAPFQIKKFEEDYKLVYCSKSESGERKCVDLGIKIDDEKNRRLVLKEGDPFKVKFKKVDEESSEEWSIV mint f4zzg4-tryp 1322689 tryp_pig PPT 1322690 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified f4zzg4_tamin TKI 1322691 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false mint t1 f4 f5 f4zzg4-1 1322689 f4zzg4_tamin TKI 1322691 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false mint t1 f3