mpidb The Microbial Protein Interaction Database hung-2012a-1 Crystal Structure of the Klebsiella pneumoniae NFeoB/FeoC Complex and Roles of FeoC in Regulation of Fe2+ Transport by the Bacterial Feo System. ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hung K.W., Tsai J.Y., Juan T.H., Hsu Y.L., Hsiao C.D., Huang T.H. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation hung-2012a-2 Crystal Structure of the Klebsiella pneumoniae NFeoB/FeoC Complex and Roles of FeoC in Regulation of Fe2+ Transport by the Bacterial Feo System. ecolx Escherichia coli itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Hung K.W., Tsai J.Y., Juan T.H., Hsu Y.L., Hsiao C.D., Huang T.H. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation hung-2012a-3 Crystal Structure of the Klebsiella pneumoniae NFeoB/FeoC Complex and Roles of FeoC in Regulation of Fe2+ Transport by the Bacterial Feo System. ecolx Escherichia coli nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Hung K.W., Tsai J.Y., Juan T.H., Hsu Y.L., Hsiao C.D., Huang T.H. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation hung-2012a-4 Crystal Structure of the Klebsiella pneumoniae NFeoB/FeoC Complex and Roles of FeoC in Regulation of Fe2+ Transport by the Bacterial Feo System. ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hung K.W., Tsai J.Y., Juan T.H., Hsu Y.L., Hsiao C.D., Huang T.H. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation a0a0j9wz82_klepn Ferrous iron transport protein B feoB KP1_5111 protein protein klebsiella pneumoniae subsp. pneumoniae ntuh-k2044 Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 MQKLTVGLIGNPNSGKTTLFNQLTGARQRVGNWAGVTVERKEGIFATTDHQVTLVDLPGTYSLTTISSQTSLDEQIACHYILSGDADMLINVVDASNLERNLYLTLQLLELGIPCVVALNMLDIAEKQQVRIDIDALAARLGCPVIPLVSTRGRGIEALKIALDRHQANSDLELVHYPQPLLREADLLAQQMSAQIPPRQRRWLGLQMLEGDIYSRAYAGDAADKLDIALANLSDEIDDPALHIADARYQTIAAICDAVSNTLTAEPSRFTAAMDKVILNRFLGLPIFLFVMYLMFLLAINIGGALQPIFDAGSVAIFVHGIQWLGYTLHFPDWLTVFLAQGIGGGINTVLPLVPQIGMMYLFLSFLEDSGYMARAAFVMDRLMQALGLPGKSFVPLIVGFGCNVPSVMGARTLDAPRERLMTIMMAPFMSCGARLAIFAVFAAAFFGQNGALAVFSLYVLGIVMAILTGLMLKHTIMRGEASPFVMELPVYHVPHIKSLIIQTWQRLKGFVLRAGKVIVIVSIFLSALNSFSLSGKVVDNINDSALASVSRVITPVFKPIGVHEDNWQATVGLFTGAMAKEVVVGTLNTLYTAEDIQNEEFNPQTFSLGEELLAAVDETWQGLKDTFSLSVLANPIEASKGDGEMATGAMGVMGSKFGSAAAAYSYLIFVLLYIPCISVMGAIARESSRGWMTFSILWGLNIAYSLSTLYYQTVSFSDHPRYSLVCILAVVLFNVVLFGLLRRARSRVDVSLLATRKTPASCCSSPAGDCH The sequence has been withdrawn from uniprot. g0glh4_klepn Ferrous iron transport protein C feoC KPN2242_21925 protein protein klebsiella pneumoniae kctc 2242 Klebsiella pneumoniae KCTC 2242 MASLMEVRDMLALQGRMEAKQLSARLQTPQPLIDAMLERMEAMGKVVRISETSEGCLSGSCKSCPEGKAACRQEWWALR The sequence has been withdrawn from uniprot. feob-q6u5s9 1340381 n/a 1340385 unspecified role unspecified role neutral component neutral component ala245cys,ala158cys mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 3.0 direct interaction direct interaction false false false figure 6 feob-feoc 1340381 n/a 1340385 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 not-defined-1739181986 1340386 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false figure 1 feob-feoc-1 1340382 n/a 1340385 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) not-defined-1086648068 1340386 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1340382 figure 2 feob-feoc-2 1340383 n/a 1340385 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 not-defined-747810050 1340386 unspecified role unspecified role unspecified role unspecified role region 2h label 2h label deuterium D2 2H2 2H2 deuterium D2 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false figure 3 feob-feoc-3 1340384 n/a 1340385 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 not-defined-449669694 1340386 unspecified role unspecified role unspecified role unspecified role Stoichiometry: 1.0 physical association physical association false false false figure 4 2.5A Rworking 21.3%, Rfree 22.1%