IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ woo-2012-3 TREK-1 and Best1 Channels Mediate Fast and Slow Glutamate Release in Astrocytes upon GPCR Activation. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Woo D.H., Han K.S., Shim J.W., Yoon B.E., Kim E., Bae J.Y., Oh S.J., Hwang E.M., Marmorstein A.D., Bae Y.C., Park J.Y., Lee C.J. Interaction involving GIRK1 could not be captured as source of construct could not be traced. cjl@kist.re.kr Cell (0092-8674) 2012 Only protein-protein interactions imex curation woo-2012-2 TREK-1 and Best1 Channels Mediate Fast and Slow Glutamate Release in Astrocytes upon GPCR Activation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Woo D.H., Han K.S., Shim J.W., Yoon B.E., Kim E., Bae J.Y., Oh S.J., Hwang E.M., Marmorstein A.D., Bae Y.C., Park J.Y., Lee C.J. cjl@kist.re.kr Cell (0092-8674) 2012 Only protein-protein interactions imex curation woo-2012-4 TREK-1 and Best1 Channels Mediate Fast and Slow Glutamate Release in Astrocytes upon GPCR Activation. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Woo D.H., Han K.S., Shim J.W., Yoon B.E., Kim E., Bae J.Y., Oh S.J., Hwang E.M., Marmorstein A.D., Bae Y.C., Park J.Y., Lee C.J. Author cites this interaction from a previously described Y2H screen (PMID:20362547), however this interaction is not described in this paper so has been included here for completeness. cjl@kist.re.kr Human brain cDNA Cell (0092-8674) 2012 Only protein-protein interactions imex curation gbg4_human Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4 GNG4 GNGT4 protein protein human Homo sapiens Human MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKFFCTIL kcnk2_rat Potassium channel subfamily K member 2 Kcnk2 Two pore potassium channel TPKC1 Outward rectifying potassium channel protein TREK-1 Stretch-activated potassium channel TREK-1 TREK-1 K(+) channel subunit Trek Two pore domain potassium channel TREK-1 protein protein rat Rattus norvegicus (Rat) Rat MLASASRERPGYTAGVAAPDLLDPKSAAQNSKPRLSFSAKPTVLASRVESDSAINVMKWKTVSTIFLVVVLYLIIGATVFKALEQPQEISQRTTIVIQKQNFIAQHACVNSTELDELIQQIVTAINAGIIPLGNNSNQVSHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALLGIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVALPAVIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYFAAVLSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATSVKRKLSAELAGNHNQELTPCRRTLSVNHLTSEREVLPPLLKAESIYLNGLTPHCAAEDIAVIENMK gbg1_mouse Guanine nucleotide-binding protein G(T) subunit gamma-T1 Gngt1 Gng1 Transducin gamma chain protein protein mouse Mus musculus Mouse MPVINIEDLTEKDKLKMEVDQLKKEVTLERMMVSKCCEEVRDYIEERSGEDPLVKGIPEDKNPFKELKGGCVIS gbg2_mouse Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 Gng2 G gamma-I protein protein mouse Mus musculus Mouse MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL gbg3_mouse Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3 Gng3 Gngt3 protein protein mouse Mus musculus Mouse MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSENPFREKKFFCALL gbg4_mouse Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4 Gng4 Gngt4 protein protein mouse Mus musculus Mouse MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAASDLLAYCEAHVREDPLIIPVPASENPFREKKFFCTIL gbg7_mouse Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7 Gng7 Gngt7 protein protein mouse Mus musculus Mouse MSGTNNVAQARKLVEQLRIEAGIERIKVSKASSDLMGYCEQHARNDPLLVGVPASENPFKDKKPCIIL gbg8_mouse Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8 Gng8 Gng9 Gngt9 Gamma-9 protein protein mouse Mus musculus Mouse MSNNMAKIAEARKTVEQLKLEVNIDRMKVSQAAAELLAFCETHAKDDPLVTPVPAAENPFRDKRLFCTLL gbg12_mouse Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12 Gng12 protein protein mouse Mus musculus Mouse MSSKTASTNSIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLMGIPTSENPFKDKKTCIIL gbg13_mouse Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13 Gng13 protein protein mouse Mus musculus Mouse MEEWDVPQMKKEVESLKYQLAFKREMSSKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKAKCTIL kcnk2-gng4-3 1330736 n/a 1330739 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1330740 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3C, 3D gngt1-kcnk2-1 1330736 n/a 1330740 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1330741 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3J gng2-kcnk2-1 1330736 n/a 1330742 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1330740 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3J gng3-kcnk2-1 1330736 n/a 1330743 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1330740 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3J gng4-kcnk2-2 1330736 n/a 1330744 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1330740 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3J gng7-kcnk2-1 1330736 n/a 1330740 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1330745 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3J gng8-kcnk2-1 1330736 n/a 1330740 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1330746 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3J gng12-kcnk2-1 1330736 n/a 1330747 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1330740 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3J gng13-kcnk2-1 1330736 n/a 1330748 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1330740 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3J kcnk2-gng4 1330737 n/a 1330739 unspecified role unspecified role prey prey n/a 1330740 unspecified role unspecified role bait bait Q920B6:p.Ala39Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 3A, 3B, Supp. Fig. 5A, 5B gng4-kcnk2-3 1330738 n/a 1330740 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q920B6:p.Ala39Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1330739 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Supp. Fig. 5A, 5C