mpidb The Microbial Protein Interaction Database monjaras_fe-2012-1 Role of EscP (Orf16) in Injectisome Biogenesis and Regulation of Type III Protein Secretion in Enteropathogenic Escherichia coli. ecolx Escherichia coli pull down pull down western blot western blot Immuno blot Immuno blot Monjaras Feria J., Garcia-Gomez E., Espinosa N., Minamino T., Namba K., Gonzalez-Pedrajo B. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation monjaras_fe-2012-2 Role of EscP (Orf16) in Injectisome Biogenesis and Regulation of Type III Protein Secretion in Enteropathogenic Escherichia coli. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Monjaras Feria J., Garcia-Gomez E., Espinosa N., Minamino T., Namba K., Gonzalez-Pedrajo B. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation cest_eco27 Tir chaperone cesT E2348C_3940 protein protein eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) MSSRSELLLDRFAEKIGVGSISFNENRLCSFAIDEIYYISLSDANDEYMMIYGVCGKFPTDNPNFALEILNANLWFAENGGPYLCYESGAQSLLLALRFPLDDATPEKLENEIEVVVKSMENLYLVLHNQGITLENEHMKIEEISSSDNKHYYAGR o52142_ecolx D3G36_10545 protein protein ecolx Escherichia coli MTRVSLKRNLIEPVSFRPSDDWPQGEESFNDIFYHIKKRSPDTLFIRMASLWKRLFYSSGRRRRYFEEGEHSFSILCGRLRGVVLTIKCSNGIIYLSIKISQNNRNHVFLYHKKDYVFDKLKEIFPDEAIEFTIEYEN q9aj18_ecolx st20 escI ABE90_014010 ACN68_25520 DIV22_19815 EAN77_23745 EAX79_25040 ERS085386_04455 ERS085411_02891 NCTC8009_02036 NCTC8179_06345 NCTC8622_07613 NCTC8960_02095 NCTC9111_01238 NCTC9703_05350 protein protein ecolx Escherichia coli MDALCHYLSHEKRLTVNMNNINQSENINIHFNKVSQTNFVDDHTPLAPTPSAAGAAQFLDQLLPKTAGVSSPEQVLIEEIKKRHLATMNTDLSFDALSAGGLSPEDVLTLQKNVLNANVNVDVVSKLASLLSTSVTKLVSMQ b7um90_eco27 escF E2348C_3932 protein protein eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) MNLSEITQQMGEVGKTLSDSVPELLNSTDLVNDPEKMLELQFAVQQYSAYVNVESGMLKTIKDLVSTISNRSF b7umb8_eco27 escU E2348C_3960 protein protein eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) MSEKTEKPTPKKLRDLKKKGDVTKSEEVMAAVQSLILFSFFSLYGMSFFVDIVGLVNTTIDSLNRPFLYAIREILGAVLNIFLLYILPISLIVFVGTVTTGVSQIGFIFAVEKIKPSAQKISVKNNLKNIFSVKSIFELLKSVFKLVIIVLIFYFMGHSYANEFANFTGLNAYQALVVVAFFVFLLWKGVLFGYLLFSVFDFWFQKHEGLKKMKMSKDEVKREAKDTDGNPEIKGERRRLHSEIQSGSLANNIKKSTVIVKNPTHIAICLYYKLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLARSLYKNIHKGQYITEDFFEPVAQLIRIAIDLDY o52142-cest 1340229 not-defined-94999718 1340231 unspecified role unspecified role prey prey p21244-- P21244-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-955192580 1340232 unspecified role unspecified role bait bait o52142-- O52142-- mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 8 o52142-esci 1340229 not-defined-14978057 1340233 unspecified role unspecified role prey prey q9aj18-- Q9AJ18-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-414960906 1340232 unspecified role unspecified role bait bait o52142-- O52142-- mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 7 o52142-escf 1340229 not-defined-2092607651 1340234 unspecified role unspecified role neutral component neutral component b7um90-- B7UM90-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-880401819 1340232 unspecified role unspecified role bait bait o52142-- O52142-- mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 7 o52142-escu 1340229 not-defined-1074218159 1340235 unspecified role unspecified role prey prey n-terminal B7UMB8-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region B7UMB8-- sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false not-defined-177486028 1340232 unspecified role unspecified role bait bait o52142-- O52142-- mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 6 o52142-cest-1 1340230 not-defined-817482632 1340231 unspecified role unspecified role prey prey not-defined-372976961 1340232 unspecified role unspecified role bait bait physical association physical association false false false figure 8 o52142-esci-1 1340230 not-defined-1756657891 1340233 unspecified role unspecified role prey prey not-defined-931506053 1340232 unspecified role unspecified role bait bait physical association physical association false false false figure 7 o52142-escf-1 1340230 not-defined-1121810809 1340232 unspecified role unspecified role bait bait not-defined-1330474700 1340234 unspecified role unspecified role prey prey physical association physical association false false false figure 7 o52142-escu-1 1340230 not-defined-1627104076 1340235 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false not-defined-790435562 1340232 unspecified role unspecified role bait bait physical association physical association false false false figure 6