MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint chang-2012-1 Agrin induces association of Chrna1 mRNA and nicotinic acetylcholine receptor in C2C12 myotubes. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Chang YF., Chou HJ., Yen YC., Chang HW., Hong YR., Huang HW., Tseng CN. FEBS Lett. (0014-5793) 2012 stau1_mouse Double-stranded RNA-binding protein Staufen homolog 1 Stau1 Stau protein protein mouse Mus musculus Mouse MYKPVDPHSRMQSTYSYGMRGGAYPPRYFYPFPVPPLLYQVELSVGGQQFNGKGKMRPPVKHDAPARALRTLQSEPLPERLEVNGREAEEENLNKSEISQVFEIALKRNLPVNFEVARESGPPHMKNFVTRVSVGEFVGEGEGKSKKISKKNAARAVLEQLRRLPPLPAVERVKPRIKKKSQPTCKTAPDYGQGMNPISRLAQIQQAKKEKEPEYMLLTERGLPRRREFVMQVKVGHHTAEGVGTNKKVAKRNAAENMLEILGFKVPQAQPAKPALKSEEKTPVKKPGDGRKVTFFEPSPGDENGTSNKDEEFRMPYLSHQQLPAGILPMVPEVAQAVGVSQGHHTKDFTRAAPNPAKATVTAMIARELLYGGTSPTAETILKSNISSGHVPHGPRTRPSEQLYYLSRAQGFQVEYKDFPKNNKNECVSLINCSSQPPLVSHGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGNGPVSACGRC mint Binds double-stranded RNA (regardless of the sequence) and tubulin. May play a role in specific positioning of mRNAs at given sites in the cell by cross-linking cytoskeletal and RNA components, and in stimulating their translation at the site acha_mouse Acetylcholine receptor subunit alpha Chrna1 Acra protein protein mouse Mus musculus Mouse MELSTVLLLLGLCSAGLVLGSEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRLPLYFIVNVIIPCLLFSFLTSLVFYLPTDSGEKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLFTMVFVIASIIITVIVINTHHRSPSTHIMPEWVRKVFIDTIPNIMFFSTMKRPSRDKQEKRIFTEDIDISDISGKPGPPPMGFHSPLIKHPEVKSAIEGVKYIAETMKSDQESNNAAEEWKYVAMVMDHILLGVFMLVCLIGTLAVFAGRLIELHQQG mint 3l21a_bunmu Alpha-bungarotoxin Long neurotoxin 1 Alpha-bungarotoxin, isoform A31 Alpha-elapitoxin-Bm2a protein protein bunmu Bungarus multicinctus Many-banded krait MKTLLLTLVVVTIVCLDLGYTIVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG mint Produces peripheral paralysis by blocking neuromuscular transmission at the postsynaptic site. Binds to muscular and neuronal (alpha-7, alpha-8, and alpha-9) nicotinic acetylcholine receptors. Blocks the extracellular increase of dopamine evoked by nicotine only at the higher dose (4.2 uM) chrna1-stau1 1307987 stau1_mouse Stau1 1307988 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level acha_mouse AChR alpha 1 1307989 predetermined predetermined participant predetermined unspecified role unspecified role bait bait cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f4b mint nxl1a-stau1 1307987 nxl1a_bunmu BTX 1307990 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified stau1_mouse Stau1 1307988 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f4b mint