MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint schulz-2012-4 Ubiquitin-specific protease-like 1 (USPL1) is a SUMO isopeptidase with essential, non-catalytic functions. in vitro In vitro enzymatic study enzymatic study experimental particp experimental participant identification experimental particp Schulz S., Chachami G., Kozaczkiewicz L., Winter U., Stankovic-Valentin N., Haas P., Hofmann K., Urlaub H., Ovaa H., Wittbrodt J., Meulmeester E., Melchior F. EMBO Rep. (1469-221X) 2012 Only protein-protein interactions imex curation schulz-2012-3 Ubiquitin-specific protease-like 1 (USPL1) is a SUMO isopeptidase with essential, non-catalytic functions. in vitro In vitro pull down pull down experimental particp experimental participant identification experimental particp Schulz S., Chachami G., Kozaczkiewicz L., Winter U., Stankovic-Valentin N., Haas P., Hofmann K., Urlaub H., Ovaa H., Wittbrodt J., Meulmeester E., Melchior F. EMBO Rep. (1469-221X) 2012 Only protein-protein interactions imex curation schulz-2012-2 Ubiquitin-specific protease-like 1 (USPL1) is a SUMO isopeptidase with essential, non-catalytic functions. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip experimental particp experimental participant identification experimental particp Schulz S., Chachami G., Kozaczkiewicz L., Winter U., Stankovic-Valentin N., Haas P., Hofmann K., Urlaub H., Ovaa H., Wittbrodt J., Meulmeester E., Melchior F. EMBO Rep. (1469-221X) 2012 Only protein-protein interactions imex curation schulz-2012-6 Ubiquitin-specific protease-like 1 (USPL1) is a SUMO isopeptidase with essential, non-catalytic functions. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging experimental particp experimental participant identification experimental particp Schulz S., Chachami G., Kozaczkiewicz L., Winter U., Stankovic-Valentin N., Haas P., Hofmann K., Urlaub H., Ovaa H., Wittbrodt J., Meulmeester E., Melchior F. EMBO Rep. (1469-221X) 2012 Only protein-protein interactions imex curation schulz-2012-1 Ubiquitin-specific protease-like 1 (USPL1) is a SUMO isopeptidase with essential, non-catalytic functions. in vitro In vitro crosslink cross-linking study crosslink experimental particp experimental participant identification experimental particp Schulz S., Chachami G., Kozaczkiewicz L., Winter U., Stankovic-Valentin N., Haas P., Hofmann K., Urlaub H., Ovaa H., Wittbrodt J., Meulmeester E., Melchior F. EMBO Rep. (1469-221X) 2012 Only protein-protein interactions imex curation schulz-2012-5 Ubiquitin-specific protease-like 1 (USPL1) is a SUMO isopeptidase with essential, non-catalytic functions. in vitro In vitro comigration in gel comigration in gel electrophoresis comigration in gel experimental particp experimental participant identification experimental particp Schulz S., Chachami G., Kozaczkiewicz L., Winter U., Stankovic-Valentin N., Haas P., Hofmann K., Urlaub H., Ovaa H., Wittbrodt J., Meulmeester E., Melchior F. EMBO Rep. (1469-221X) 2012 Only protein-protein interactions imex curation uspl1_human SUMO-specific isopeptidase USPL1 Ubiquitin-specific peptidase-like protein 1 USPL1 C13orf22 D13S106 protein protein human Homo sapiens Human MMDSPKIGNGLPVIGPGTDIGISSLHMVGYLGKNFDSAKVPSDEYCPACREKGKLKALKTYRISFQESIFLCEDLQCIYPLGSKSLNNLISPDLEECHTPHKPQKRKSLESSYKDSLLLANSKKTRNYIAIDGGKVLNSKHNGEVYDETSSNLPDSSGQQNPIRTADSLERNEILEADTVDMATTKDPATVDVSGTGRPSPQNEGCTSKLEMPLESKCTSFPQALCVQWKNAYALCWLDCILSALVHSEELKNTVTGLCSKEESIFWRLLTKYNQANTLLYTSQLSGVKDGDCKKLTSEIFAEIETCLNEVRDEIFISLQPQLRCTLGDMESPVFAFPLLLKLETHIEKLFLYSFSWDFECSQCGHQYQNRHMKSLVTFTNVIPEWHPLNAAHFGPCNNCNSKSQIRKMVLEKVSPIFMLHFVEGLPQNDLQHYAFHFEGCLYQITSVIQYRANNHFITWILDADGSWLECDDLKGPCSERHKKFEVPASEIHIVIWERKISQVTDKEAACLPLKKTNDQHALSNEKPVSLTSCSVGDAASAETASVTHPKDISVAPRTLSQDTAVTHGDHLLSGPKGLVDNILPLTLEETIQKTASVSQLNSEAFLLENKPVAENTGILKTNTLLSQESLMASSVSAPCNEKLIQDQFVDISFPSQVVNTNMQSVQLNTEDTVNTKSVNNTDATGLIQGVKSVEIEKDAQLKQFLTPKTEQLKPERVTSQVSNLKKKETTADSQTTTSKSLQNQSLKENQKKPFVGSWVKGLISRGASFMPLCVSAHNRNTITDLQPSVKGVNNFGGFKTKGINQKASHVSKKARKSASKPPPISKPPAGPPSSNGTAAHPHAHAASEVLEKSGSTSCGAQLNHSSYGNGISSANHEDLVEGQIHKLRLKLRKKLKAEKKKLAALMSSPQSRTVRSENLEQVPQDGSPNDCESIEDLLNELPYPIDIASESACTTVPGVSLYSSQTHEEILAELLSPTPVSTELSENGEGDFRYLGMGDSHIPPPVPSEFNDVSQNTHLRQDHNYCSPTKKNPCEVQPDSLTNNACVRTLNLESPMKTDIFDEFFSSSALNALANDTLDLPHFDEYLFENY sumo1_human Small ubiquitin-related modifier 1 SUMO1 Sentrin Ubiquitin-like protein SMT3C Ubiquitin-homology domain protein PIC1 Ubiquitin-like protein UBL1 GAP-modifying protein 1 SMT3 homolog 3 SMT3C SMT3H3 UBL1 OK/SW-cl.43 protein protein human Homo sapiens Human MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV sumo3_human Small ubiquitin-related modifier 3 SMT3 homolog 1 SUMO-2 SMT3H1 SUMO3 SMT3A Ubiquitin-like protein SMT3A protein protein human Homo sapiens Human MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF senp1_human Sentrin-specific protease 1 SENP1 Sentrin/SUMO-specific protease SENP1 protein protein human Homo sapiens Human MDDIADRMRMDAGEVTLVNHNSVFKTHLLPQTGFPEDQLSLSDQQILSSRQGHLDRSFTCSTRSAAYNPSYYSDNPSSDSFLGSGDLRTFGQSANGQWRNSTPSSSSSLQKSRNSRSLYLETRKTSSGLSNSFAGKSNHHCHVSAYEKSFPIKPVPSPSWSGSCRRSLLSPKKTQRRHVSTAEETVQEEEREIYRQLLQMVTGKQFTIAKPTTHFPLHLSRCLSSSKNTLKDSLFKNGNSCASQIIGSDTSSSGSASILTNQEQLSHSVYSLSSYTPDVAFGSKDSGTLHHPHHHHSVPHQPDNLAASNTQSEGSDSVILLKVKDSQTPTPSSTFFQAELWIKELTSVYDSRARERLRQIEEQKALALQLQNQRLQEREHSVHDSVELHLRVPLEKEIPVTVVQETQKKGHKLTDSEDEFPEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEKGLPSVHAFNTFFFTKLKTAGYQAVKRWTKKVDVFSVDILLVPIHLGVHWCLAVVDFRKKNITYYDSMGGINNEACRILLQYLKQESIDKKRKEFDTNGWQLFSKKSQEIPQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL uspl1_danre SUMO-specific isopeptidase USPL1 uspl1 Ubiquitin-specific peptidase-like protein 1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MNGEGTGIGAPTPALAGFLGKSKDRNASPGNCPWCLAKGQTNALRFYAVNLKETVLLCTNAVCLYPLVSRSLEEVRASLSKGGCKRSISSLPDISDDSCPPKRPREEKLDVLADVSEPCDAEVNDATLPDDTVKTQTFTDQQSAPAETISLDKTEEQPVSIEDIKEQPISHDATEGQPISIDQTEEQPVSILHTEEQPIVLDLIEVKPMSVDHSEEQPICIDNTKERPVSIVHTEEQSIVLDLFEVKPMSIAHTEEKPTSFDHIEEKPMSIAHTEEKPVSLVHTEDQHLSIDQTEEQPISIDPTEEQQPEELPAVSDEDVDLCERKEDCVSSTQDEMEEEVLESSSELVPVHSELFWKNEENMCWLDAMLVMLVHCRTIRGTPCRGIKLSDKLATVPCNDSVVWKLCWRYDKTCAYLQARKKQSEDKVLRVPAGVLVEAERRLSALRLSVFKLLQPTLKCEIGQQETPVFALPLLLRSDKWAQDIFQHTIRWEFKCTCCDFTVNESVEKTLTTLTCIVKDWHPLKANNRTQCNKCEHKNQRRKMVLEKLSSVFALHFVEGLPRKDLTKYGFTFQGFQYSVSTIIQYNKHLQHFVTWVRQSNGFWLELDDLKHPYSPTHKRLPFPSSEFHILFWETDSFKEEHSEVCLPTAPPEVPNAPDEHPPKLSDSVATDTCVISALTVEDTTASSIADTSIGSTTLLDTFEGLTHKDIVTLTLVNSESPKNEPRPMRPGFVSAPRHCPFEASNLLSGIPKTGSRLSTPPIPQKSSLVHKPEVAAAAVSKTHLQPTSLFQRHPSFQSTPIRPPPPLPPAPKPKPSLQYDKHEDLPVKPADMFGGFKTKKLANSQPKQISLPGGLNPSVKKTAGQEPISTTEALRLKLMKKLKAKKKKLAKLNQLLGNGGESVAKPDSTALSSPYSVTSSTTTYDSFDDQFLADLLSPATTVSNLSPDSTGLLEMLNNGQNGEQQNPAVATLAPEATLTCSSSTISPLDEYMQSGMCHTALENADFNSLDIFF mint sumo2_human Small ubiquitin-related modifier 2 SMT3 homolog 2 Sentrin-2 HSMT3 SUMO-3 SUMO2 SMT3H2 SMT3B Ubiquitin-like protein SMT3B protein protein human Homo sapiens Human MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY coil_human Coilin COIL CLN80 p80-coilin protein protein human Homo sapiens Human MAASETVRLRLQFDYPPPATPHCTAFWLLVDLNRCRVVTDLISLIRQRFGFSSGAFLGLYLEGGLLPPAESARLVRDNDCLRVKLEERGVAENSVVISNGDINLSLRKAKKRAFQLEEGEETEPDCKYSKKHWKSRENNNNNEKVLDLEPKAVTDQTVSKKNKRKNKATCGTVGDDNEEAKRKSPKKKEKCEYKKKAKNPKSPKVQAVKDWANQRCSSPKGSARNSLVKAKRKGSVSVCSKESPSSSSESESCDESISDGPSKVTLEARNSSEKLPTELSKEEPSTKNTTADKLAIKLGFSLTPSKGKTSGTTSSSSDSSAESDDQCLMSSSTPECAAGFLKTVGLFAGRGRPGPGLSSQTAGAAGWRRSGSNGGGQAPGASPSVSLPASLGRGWGREENLFSWKGAKGRGMRGRGRGRGHPVSCVVNRSTDNQRQQQLNDVVKNSSTIIQNPVETPKKDYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVVEYAVTQESKITVFWKELIDPRLIIESPSNTSSTEPA sumo1-uspl1-2 1331504 sumo-specific isopep USPL1 1331510 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false sumo1_human SUMO1 1331511 tag fluorescence tag visualisation by fluorescence tag fluorescence enzyme target enzyme target substrate substrate neutral component neutral component purified purified fluorescent prot tag fluorescent prot tag fluorescent protein tag fluorescent prot tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cleavage cleavage reaction cleavage false false false f2c homomint mint sumo3-uspl1-6 1331504 sumo-specific isopep USPL1 1331510 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Q5W0Q7:p.Trp229Leu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false sumo3_human SUMO2 1331512 tag fluorescence tag visualisation by fluorescence tag fluorescence enzyme target enzyme target substrate substrate neutral component neutral component purified purified fluorescent prot tag fluorescent prot tag fluorescent protein tag fluorescent prot tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cleavage cleavage reaction cleavage false false false homomint mint f2c f4b sumo1-uspl1-3 1331504 sumo1_human SUMO1 1331511 weight by comassie molecular weight estimation by coomasie staining weight by comassie enzyme target enzyme target substrate substrate neutral component neutral component purified purified sumo-specific isopep USPL1 1331510 weight by comassie molecular weight estimation by coomasie staining weight by comassie enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false f2d homomint mint sumo3-uspl1-7 1331504 sumo-specific isopep USPL1 1331510 weight by comassie molecular weight estimation by coomasie staining weight by comassie enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false sumo3_human SUMO2 1331512 weight by comassie molecular weight estimation by coomasie staining weight by comassie enzyme target enzyme target substrate substrate neutral component neutral component purified purified cleavage cleavage reaction cleavage false false false f2d homomint mint senp1-sumo1-2 1331504 senp1_human SENP1 1331513 weight by comassie molecular weight estimation by coomasie staining weight by comassie enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false sumo1_human SUMO1 1331511 weight by comassie molecular weight estimation by coomasie staining weight by comassie enzyme target enzyme target substrate substrate neutral component neutral component purified purified cleavage cleavage reaction cleavage false false false f2d homomint mint senp1-sumo3 1331504 sumo3_human SUMO2 1331512 weight by comassie molecular weight estimation by coomasie staining weight by comassie enzyme target enzyme target substrate substrate neutral component neutral component purified purified senp1_human SENP1 1331513 weight by comassie molecular weight estimation by coomasie staining weight by comassie enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false f2d homomint mint sumo1-uspl1-4 1331504 sumo-specific isopep C13orf22l 1331514 weight by comassie molecular weight estimation by coomasie staining weight by comassie enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false sumo1_human SUMO1 1331511 weight by comassie molecular weight estimation by coomasie staining weight by comassie enzyme target enzyme target substrate substrate neutral component neutral component purified purified cleavage cleavage reaction cleavage false false false f3d mint sumo1-uspl1-5 1331504 sumo1_human SUMO1 1331511 weight by comassie molecular weight estimation by coomasie staining weight by comassie enzyme target enzyme target substrate substrate neutral component neutral component purified purified sumo-specific isopep USPL1 1331510 weight by comassie molecular weight estimation by coomasie staining weight by comassie enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false f3d homomint mint sumo3-uspl1-8 1331504 sumo3_human SUMO2 1331512 weight by comassie molecular weight estimation by coomasie staining weight by comassie enzyme target enzyme target substrate substrate neutral component neutral component purified purified sumo-specific isopep USPL1 1331510 weight by comassie molecular weight estimation by coomasie staining weight by comassie enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false f3d homomint mint sumo2-uspl1-2 1331504 sumo-specific isopep C13orf22l 1331514 weight by comassie molecular weight estimation by coomasie staining weight by comassie enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false sumo2_human SUMO3 1331515 weight by comassie molecular weight estimation by coomasie staining weight by comassie enzyme target enzyme target substrate substrate neutral component neutral component purified purified cleavage cleavage reaction cleavage false false false f3e mint sumo3-uspl1-9 1331504 sumo3_human SUMO2 1331512 predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified sumo-specific isopep USPL1 1331510 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q5W0Q7:p.Trp237Phe mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false homomint mint f2c f4b sumo3-uspl1-10 1331504 sumo3_human SUMO2 1331512 predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified sumo-specific isopep USPL1 1331510 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Q5W0Q7:p.His421Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false homomint mint f2c f4b sumo3-uspl1-11 1331504 sumo3_human SUMO2 1331512 predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified sumo-specific isopep USPL1 1331510 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Q5W0Q7:p.Leu340Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q5W0Q7:p.Leu341Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false false false homomint mint f2c f4b sumo3-uspl1-12 1331504 sumo-specific isopep USPL1 1331510 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Q5W0Q7:p.Ile494Val mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q5W0Q7:p.Val495Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false sumo3_human SUMO2 1331512 predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified cleavage cleavage reaction cleavage false false false homomint mint f2c f4b sumo3-uspl1-13 1331504 sumo-specific isopep C13orf22l 1331514 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false sumo3_human SUMO2 1331512 predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified cleavage cleavage reaction cleavage false false false mint sf4b sumo3-uspl1 1331505 sumo3_human SUMO2 1331512 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified sumo-specific isopep USPL1 1331510 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q5W0Q7:p.Trp229Leu mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false homomint mint f2a f2b f4c sumo1-uspl1-1 1331505 sumo1_human SUMO1 1331511 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified sumo-specific isopep USPL1 1331510 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q5W0Q7:p.Cys236Ser mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f2b homomint mint sumo3-uspl1-1 1331505 sumo3_human SUMO2 1331512 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified sumo-specific isopep USPL1 1331510 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q5W0Q7:p.Trp237Phe mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false homomint mint f2a f2b f4c sumo3-uspl1-2 1331505 sumo-specific isopep USPL1 1331510 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified Q5W0Q7:p.Glu331Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false sumo3_human SUMO2 1331512 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified direct interaction direct interaction false false false homomint mint f2a f2b f4c sumo3-uspl1-3 1331505 sumo-specific isopep USPL1 1331510 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified Q5W0Q7:p.His421Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false sumo3_human SUMO2 1331512 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified direct interaction direct interaction false false false homomint mint f2a f2b f4c sumo3-uspl1-4 1331505 sumo3_human SUMO2 1331512 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified sumo-specific isopep USPL1 1331510 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified Q5W0Q7:p.Leu340Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q5W0Q7:p.Leu341Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false homomint mint f2a f2b f4c sumo3-uspl1-5 1331505 sumo-specific isopep USPL1 1331510 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q5W0Q7:p.Val495Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q5W0Q7:p.Ile494Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false sumo3_human SUMO2 1331512 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified direct interaction direct interaction false false false homomint mint f2a f2b f4c sumo1-uspl1 1331506 sumo1_human SUMO1 1331511 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false sumo-specific isopep USPL1 1331510 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f1c f1d homomint mint sumo2-uspl1-1 1331506 sumo2_human SUMO3 1331515 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false sumo-specific isopep USPL1 1331510 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f1c f1d homomint mint coil-uspl1 1331507 sumo-specific isopep USPL1 1331510 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false coil_human Coilin 1331516 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false homomint mint f5c f5h coil-uspl1-1 1331507 coil_human Coilin 1331516 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell sumo-specific isopep USPL1 1331510 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f5c homomint mint senp1-sumo1-1 1331508 senp1_human SENP1 1331513 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false sumo1_human SUMO1 1331511 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified tandem tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f1b homomint mint sumo2-uspl1-3 1331509 sumo-specific isopep C13orf22l 1331514 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false sumo2_human SUMO3 1331515 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f3c mint