MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint park-2012-1 Dual apoptotic DNA fragmentation system in the fly: Drep2 is a novel nuclease of which activity is inhibited by Drep3. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Park OK., Park HH. FEBS Lett. (0014-5793) 2012 park-2012-2 Dual apoptotic DNA fragmentation system in the fly: Drep2 is a novel nuclease of which activity is inhibited by Drep3. in vitro In vitro bn-page blue native page bn-page predetermined predetermined participant predetermined Park OK., Park HH. FEBS Lett. (0014-5793) 2012 q9u787_drome Drep2 Drep-2 Rep2 drep2 CG1975 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAREESRGKRPLKIWDSWRNVRKGVVVGTFEELLVRGKDKLGVPASEPVRVVLECDGTQIEDGEYFRTLANNTVLLLLRQGERWYPTGVDVIKAAISAIPKIVCETIHALELHDETPSWKIMDNKGRVTVVLHWDQRQGGGSGGGESGGAGGGVGSMCSRLGSSNGLLSSDKYSPSKKGLSAQSSLDNKSVSSQSSQPRYASPQITVISDDGPASIYHPGGVVLPPGVVIPGGSRRLSKQGSSFDSTVGVGVGAVHVHTPECAHHAHTPSRAGSPSTTECDFHCCALHEEGRKIAVHKSVATSPIQDGSSSPQPQSAPSVMDPMLGGSGGGGSGSMQRRSSGAKGHVRFLDIAPERDSSESETENTVMEDDKTTTEKFLLLIDQLSVDQKRHLSIKDIGIILERLNSKILDVERLDRESESDDCYNWTIKATIRGDALRELGVIYNANYYAISEHPGYKEELEENGEEVEEEEEEDEEDRI mint q0e9b7_drome Drep3 Drep-3 Rep3 BcDNA:AT08574 CG13187 DREP-3 Dmel\CG8364 drep-3 drep3 CG8364 Dmel_CG8364 DREP3 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTAMNADETKLAGMPQGAEEEQEPEREQKKESDGAAAAAGVQCDPDSRIVAPPPRQRTLTRTAELDADCEDIELDADDGLDDAADSITLELALSPHSSATPTPSPTTADEDFAQLDNSKPFKIKDITRNIRKAVVATTLSELRTKVSLKFERAQPAIHLDCDGTEVDDEEYFSTLEPNAELIAVFPGEQWRDPSDYNANLRRTSLDAQRLRSLVSKLQPNYMNDDDLDKLSNMDPNSLVDITGREPKDNEYSARSDAARLSTELSC drep_2-drep_3 1307259 drep2 Drep2 CIDE 1307261 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false drep-3 Drep-3 CIDE 1307262 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f2a mint drep_2-drep_3-1 1307260 drep2 Drep2 CIDE 1307261 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false drep-3 Drep-3 CIDE 1307262 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f2b mint