MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint qiu-2012-2 Pol II CTD kinases Bur1 and Kin28 promote Spt5 CTR-independent recruitment of Paf1 complex. in vitro In vitro protein array protein array experimental particp experimental participant identification experimental particp Qiu H., Hu C., Gaur NA., Hinnebusch AG. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation qiu-2012-1 Pol II CTD kinases Bur1 and Kin28 promote Spt5 CTR-independent recruitment of Paf1 complex. yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip experimental particp experimental participant identification experimental particp Qiu H., Hu C., Gaur NA., Hinnebusch AG. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation rpb1_yeast DNA-directed RNA polymerase II subunit RPB1 RPO21 RPB220 RPB1 SUA8 YDL140C D2150 DNA-directed RNA polymerase III largest subunit RNA polymerase II subunit B220 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQLVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLPVPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPGAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVIPTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNIRRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRAAMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEATSPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR A45C1360FF99F968 rtf1_yeast RNA polymerase-associated protein RTF1 RTF1 YGL244W HRA458 CSL3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDLDEDLLALAGADESEEEDQVLTTTSAKRAKNNDQSLSKKRRIEVGSVEDDDEEDDYNPYSVGNADYGSEEEEEANPFPLEGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRAKNDEDSRKTRASTRSTHATGHSDIKASKLSQLKKQRARKNRHYSDNEDEDDEEDYREEDYKDDEGSEYGDDEEYNPFDRRDTYDKREEVEWAEEEDEQDREPEISDFNKLRIGRSFVAKFCFYPGFEDAVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGKFYTNQYFGVTQGKDRKVFQMNYFSDGLFAEDEYQRYLRALDNSQMIKPSLHSLSNKTKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDSNNFDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEIAQQEKLQEDKDAKDKREKELLVAQFRRLGGLERMVGELDIKFDLKF 13AECCEC6D63CED4 cdc73_yeast Cell division control protein 73 RNA polymerase-associated protein CDC73 CDC73 YLR418C protein protein yeast Saccharomyces cerevisiae Baker's yeast MANSLDRLREHLKNGDKLVLKNNEGQSTDDITKATMVETLSSDGSTQDSFPLNEETEIEIDGSLVQLRIIVHCWMNKDSSAADYLADCQNKQLTNVSFLQRTDLINWLSGNTESSQYLKAPGQKGETSDKVDIENKTLAGELSTVKSTTSASLENDSEVSDPVVVETMKHERILVDHNSALRGAKPINFGYLIKDAELKLVQSIKGSLRGSKLPPGHKGAHGRISKTNGSSGGPRKDPIILIPSAASSILTVANIKQFLLESKYVNPRNLPSVPNGLVNIEKNFERISRPIRFIIVDNTRMFTKPEYWDRVVAIFTTGHTWQFNNYQWNSPQELFQRCKGYYFHFAGDSVPQHVQQWNVEKVELDKNKRFKDVEVVRYFWHSLEKELISRGYR 9580B53EEFB75345 ctr9_yeast RNA polymerase-associated protein CTR9 CTR9 CDP1 Cln three-requiring protein 9 Centromere-binding factor 1-dependent protein 1 YOL145C protein protein yeast Saccharomyces cerevisiae Baker's yeast MTNAMKVEGYPSMEWPTSLDIPLKASEELVGIDLETDLPDDPTDLKTLLVEENSEKEHWLTIALAYCNHGKTNEGIKLIEMALDVFQNSERASLHTFLTWAHLNLAKGQSLSVETKEHELTQAELNLKDAIGFDPTWIGNMLATVELYYQRGHYDKALETSDLFVKSIHAEDHRSGRQSKPNCLFLLLRAKLLYQKKNYMASLKIFQELLVINPVLQPDPRIGIGLCFWQLKDSKMAIKSWQRALQLNPKNTSASILVLLGEFRESFTNSTNDKTFKEAFTKALSDLNNIFSENQHNPVLLTLLQTYYYFKGDYQTVLDIYHHRILKMSPMIAKIVLSESSFWCGRAHYALGDYRKSFIMFQESLKKNEDNLLAKLGLGQTQIKNNLLEESIITFENLYKTNESLQELNYILGMLYAGKAFDAKTAKNTSAKEQSNLNEKALKYLERYLKLTLATKNQLVISRAYLVISQLYELQNQYKTSLDYLSKALEEMEFIKKEIPLEVLNNLACYHFINGDFIKADDLFKQAKAKVSDKDESVNITLEYNIARTNEKNDCEKSESIYSQVTSLHPAYIAARIRNLYLKFAQSKIEDSDMSTEMNKLLDLNKSDLEIRSFYGWYLKNSKERKNNEKSTTHNKETLVKYNSHDAYALISLANLYVTIARDGKKSRNPKEQEKSKHSYLKAIQLYQKVLQVDPFNIFAAQGLAIIFAESKRLGPALEILRKVRDSLDNEDVQLNLAHCYLEMREYGKAIENYELVLKKFDNEKTRPHILNLLGRAWYARAIKERSVNFYQKALENAKTALDLFVKESSKSKFIHSVKFNIALLHFQIAETLRRSNPKFRTVQQIKDSLEGLKEGLELFRELNDLKEFNMIPKEELEQRIQLGETTMKSALERSLNEQEEFEKEQSAKIDEARKILEENELKEQGWMKQEEEARRLKLEKQAEEYRKLQDEAQKLIQEREAMAISEHNVKDDSDLSDKDNEYDEEKPRQKRKRSTKTKNSGESKRRKAAKKTLSDSDEDDDDVVKKPSHNKGKKSQLSNEFIEDSDEEEAQMSGSEQNKNDDNDENNDNDDNDGLF F794ECBAD26D4820 spt5_yeast Transcription elongation factor SPT5 SPT5 YML010W YM9571.08 Chromatin elongation factor SPT5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDNSDTNVSMQDHDQQFADPVVVPQSTDTKDENTSDKDTVDSGNVTTTESTERAESTSNIPPLDGEEKEAKSEPQQPEDNAETAATEQVSSSNGPATDDAQATLNTDSSEANEIVKKEEGSDERKRPREEDTKNSDGDTKDEGDNKDEDDDEDDDDDDDDEDDDDEAPTKRRRQERNRFLDIEAEVSDDEDEDEDEEDSELVREGFITHGDDEDDEASAPGARRDDRLHRQLDQDLNKTSEEDAQRLAKELRERYGRSSSKQYRAAAQDGYVPQRFLLPSVDTATIWGVRCRPGKEKELIRKLLKKKFNLDRAMGKKKLKILSIFQRDNYTGRIYIEAPKQSVIEKFCNGVPDIYISQKLLIPVQELPLLLKPNKSDDVALEEGSYVRIKRGIYKGDLAMVDQISENNLEVMLKIVPRLDYGKFDEIDPTTQQRKSRRPTFAHRAPPQLFNPTMALRLDQANLYKRDDRHFTYKNEDYIDGYLYKSFRIQHVETKNIQPTVEELARFGSKEGAVDLTSVSQSIKKAQAAKVTFQPGDRIEVLNGEQRGSKGIVTRTTKDIATIKLNGFTTPLEFPISTLRKIFEPGDHVTVINGEHQGDAGLVLMVEQGQVTFMSTQTSREVTITANNLSKSIDTTATSSEYALHDIVELSAKNVACIIQAGHDIFKVIDETGKVSTITKGSILSKINTARARVSSVDANGNEIKIGDTIVEKVGSRREGQVLYIQTQQIFVVSKKIVENAGVFVVNPSNVEAVASKDNMLSNKMDLSKMNPEIISKMGPPSSKTFQQPIQSRGGREVALGKTVRIRSAGYKGQLGIVKDVNGDKATVELHSKNKHITIDKHKLTYYNREGGEGITYDELVNRRGRVPQARMGPSYVSAPRNMATGGIAAGAAATSSGLSGGMTPGWSSFDGGKTPAVNAHGGSGGGGVSSWGGASTWGGQGNGGASAWGGAGGGASAWGGQGTGATSTWGGASAWGNKSSWGGASTWASGGESNGAMSTWGGTGDRSAYGGASTWGGNNNNKSTRDGGASAWGNQDDGNRSAWNNQGNKSNYGGNSTWGGH E4324DB6B1E4721A paf1_yeast RNA polymerase II-associated protein 1 PAF1 YBR279W YBR2016 Protein PAF1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKKQEYIAPIKYQNSLPVPQLPPKLLVYPESPETNADSSQLINSLYIKTNVTNLIQQDEDLGMPVDLMKFPGLLNKLDSKLLYGFDNVKLDKDDRILLRDPRIDRLTKTDISKVTFLRRTEYVSNTIAAHDNTSLKRKRRLDDGDSDDENLDVNHIISRVEGTFNKTDKWQHPVKKGVKMVKKWDLLPDTASMDQVYFILKFMGSASLDTKEKKSLNTGIFRPVELEEDEWISMYATDHKDSAILENELEKGMDEMDDDSHEGKIYKFKRIRDYDMKQVAEKPMTELAIRLNDKDGIAYYKPLRSKIELRRRRVNDIIKPLVKEHDIDQLNVTLRNPSTKEANIRDKLRMKFDPINFATVDEEDDEDEEQPEDVKKESEGDSKTEGSEQEGENEKDEEIKQEKENEQDEENKQDENRAADTPETSDAVHTEQKPEEEKETLQEE rpo21-rtf1 1344038 rpb1_yeast CTD 1344040 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P04050:p.Ser1557Asp mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm P04050:p.Ser1560Asp mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rtf1_yeast Rtf1 1344041 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey partially purified partially purified direct interaction direct interaction false false false f1a f1b rpo21-rtf1-1 1344038 rpb1_yeast CTD 1344040 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm rtf1_yeast Rtf1 1344041 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey partially purified partially purified direct interaction direct interaction false false false f1a rpo21-cdc73 1344038 rpb1_yeast CTD 1344040 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cdc73_yeast Cdc73 1344042 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey partially purified partially purified tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f1a mint rpo21-cdc73-1 1344038 rpb1_yeast CTD 1344040 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cdc73_yeast Cdc73 1344042 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey partially purified partially purified tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f1a sf10a rpo21-rtf1-2 1344038 rtf1_yeast Rtf1 1344041 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rpb1_yeast CTD 1344040 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P04050:p.Ser1560Asp mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm P04050:p.Ser1557Asp mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm direct interaction direct interaction false false false f1c f1d sf2 rpo21-cdc73-2 1344038 rpb1_yeast CTD 1344040 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified P04050:p.Ser1560Asp mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P04050:p.Ser1557Asp mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cdc73_yeast Cdc73 1344042 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f1c sf2 sf11b rpo21-cdc73-3 1344038 rpb1_yeast CTD 1344040 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cdc73_yeast Cdc73 1344042 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false sf2b rpo21-cdc73-4 1344038 rpb1_yeast CTD 1344040 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P04050:p.Ser1560Asp mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false cdc73_yeast Cdc73 1344042 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false sf2b f1c sf11b rpo21-cdc73-5 1344038 cdc73_yeast Cdc73 1344042 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rpb1_yeast CTD 1344040 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm direct interaction direct interaction false false false sf2b rpo21-cdc73-6 1344038 cdc73_yeast Cdc73 1344042 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rpb1_yeast CTD 1344040 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false sf2b f1c sf11b rpo21-ctr9 1344038 rpb1_yeast CTD 1344040 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ctr9_yeast Ctr9 1344043 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false sf2 f1d f1c rpo21-ctr9-1 1344038 rpb1_yeast CTD 1344040 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ctr9_yeast Ctr9 1344043 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false sf2 f1d f1c rpo21-ctr9-2 1344038 rpb1_yeast CTD 1344040 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm ctr9_yeast Ctr9 1344043 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false sf2 f1c rpo21-ctr9-3 1344038 ctr9_yeast Ctr9 1344043 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false rpb1_yeast CTD 1344040 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f1c rpo21-rtf1-3 1344038 rpb1_yeast CTD 1344040 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm P04050:p.Ser1557Asp mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm P04050:p.Ser1560Asp mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rtf1_yeast Rtf1 1344041 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey partially purified partially purified direct interaction direct interaction false false false f1a f1b rpo21-rtf1-4 1344038 rpb1_yeast CTD 1344040 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm rtf1_yeast Rtf1 1344041 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false sf2e spt5-rtf1 1344038 spt5_yeast CTD 1344044 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false SAWGGQSAWGGQSAWGGQSAWGGQ undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false rtf1_yeast Rtf1 1344041 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false sf2f sf11c spt5-rtf1-1 1344038 rtf1_yeast Rtf1 1344041 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey partially purified partially purified spt5_yeast CTD 1344044 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false SAWGGQSAWGGQSAWGGQSAWGGQ phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f2a spt5-cdc73 1344038 spt5_yeast CTD 1344044 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false SAWGGQSAWGGQSAWGGQSAWGGQ phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false cdc73_yeast Cdc73 1344042 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey partially purified partially purified direct interaction direct interaction false false false f2a sf10a spt5-cdc73-1 1344038 spt5_yeast CTD 1344044 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false SAWGGQSAWGGQSAWGGQSAWGGQ cdc73_yeast Cdc73 1344042 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f2b f2c f2d spt5-ctr9 1344038 ctr9_yeast Ctr9 1344043 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spt5_yeast CTR 1344044 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm direct interaction direct interaction false false false f1c spt5-rtf1-2 1344038 rtf1_yeast Rtf1 1344041 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spt5_yeast CTD 1344044 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false SAWGGQSAWGGQSAWGGQSAWGGQ direct interaction direct interaction false false false f2b f2c f2d rpo21-cdc73-7 1344038 cdc73_yeast Cdc73 1344042 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified Q06697:p.Trp380Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q06697:p.Trp357Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rpb1_yeast CTD 1344040 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f3a f3b spt5-cdc73-2 1344038 spt5_yeast CTR 1344044 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cdc73_yeast Cdc73 1344042 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified Q06697:p.Trp380Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q06697:p.Trp357Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f3D sf10b spt5-cdc73-3 1344038 cdc73_yeast Cdc73 1344042 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q06697:p.Trp380Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false spt5_yeast CTR 1344044 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm direct interaction direct interaction false false false f3D spt5-cdc73-4 1344038 spt5_yeast CTR 1344044 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm cdc73_yeast Cdc73 1344042 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f3D spt5-cdc73-5 1344038 spt5_yeast CTR 1344044 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm cdc73_yeast Cdc73 1344042 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false undefined mutation mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f3D rpo21-cdc73-8 1344038 cdc73_yeast Cdc73 1344042 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q06697:p.Trp380Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false rpb1_yeast CTD 1344040 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f3a f3b sf10b rpo21-cdc73-9 1344038 rpb1_yeast CTD 1344040 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cdc73_yeast Cdc73 1344042 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q06697:p.Trp380Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f3b f3a sf10b rpo21-cdc73-10 1344038 rpb1_yeast CTD 1344040 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm cdc73_yeast Cdc73 1344042 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified Q06697:p.Trp357Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q06697:p.Trp380Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f3b f3a rpo21-cdc73-11 1344038 rpb1_yeast CTD 1344040 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cdc73_yeast Cdc73 1344042 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified Q06697:p.Trp380Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q06697:p.Trp357Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f3b sf10b rpo21-cdc73-12 1344038 rpb1_yeast CTD 1344040 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cdc73_yeast Cdc73 1344042 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q06697:p.Trp380Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f3b rpo21-cdc73-13 1344038 rpb1_yeast CTD 1344040 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm cdc73_yeast Cdc73 1344042 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f3c rpo21-cdc73-14 1344038 rpb1_yeast CTD 1344040 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm cdc73_yeast Cdc73 1344042 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f3c rpo21-cdc73-15 1344038 cdc73_yeast Cdc73 1344042 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified undefined mutation mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false rpb1_yeast CTD 1344040 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f3c rpo21-cdc73-16 1344038 cdc73_yeast Cdc73 1344042 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rpb1_yeast CTD 1344040 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f3c cdc73-rtf1-14 1344039 rtf1_yeast Rtf1 1344041 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level cdc73_yeast CDC73 1344042 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f4a sf10c cdc73-paf1-9 1344039 paf1_yeast Paf1 1344045 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cdc73_yeast CDC73 1344042 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false sf4b