mpidb The Microbial Protein Interaction Database agari-2012-1 Transcriptional repression mediated by a TetR family protein, PfmR, from Thermus thermophilus HB8. ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Agari Y., Sakamoto K., Kuramitsu S., Shinkai A. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation agari-2012-2 Transcriptional repression mediated by a TetR family protein, PfmR, from Thermus thermophilus HB8. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Agari Y., Sakamoto K., Kuramitsu S., Shinkai A. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation q53wd9_thet8 TTHB023 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MVTTTRDRILEEAAKLFTEKGYEATSVQDLAQALGLSKAALYHHFGSKEEILYEISLLALKGLVAAGEKALEVADPKEALRRFMEAHARYFEENYPFFVTMLQGIKSLSPENRLKTIALRDRHEENLRAILRRGVEQGVFREVDVALAGRAVLSMLNWMIRWFRPDGPMRAEEVARAYHDLILRGLERGSA q53wd9-q53wd9-2 1339988 not-defined-1410261182 1339990 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.0 direct interaction direct interaction false false false figure 7 q53wd9-q53wd9-1 1339989 not-defined-466081146 1339990 unspecified role unspecified role unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false q53wd9-- Q53WD9-- se(s)met L-selenomethionine Delta:S(-1)Se(1) Se(S)Met Selenium replaces sulphur semetm undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 direct interaction direct interaction false false false figure 6 The asymmetric unit of the crystal comprised two homodimers 2.27A Rworking = 0.21 Rfree = 0.27