MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint she-2012-1 Structural and SAXS analysis of the budding yeast SHU-complex proteins. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined She Z., Gao ZQ., Liu Y., Wang WJ., Liu GF., Shtykova EV., Xu JH., Dong YH. FEBS Lett. (0014-5793) 2012 she-2012-2 Structural and SAXS analysis of the budding yeast SHU-complex proteins. in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined She Z., Gao ZQ., Liu Y., Wang WJ., Liu GF., Shtykova EV., Xu JH., Dong YH. FEBS Lett. (0014-5793) 2012 csm2_yeast Chromosome segregation in meiosis protein 2 YIL132C CSM2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MEYEDLELITIWPSPTKNKLCQFIKQNLSKEHVVTQLFFIDATSSFPLSQFQKLVPPTLPENVRIYENIRINTCLDLEELSAITVKLLQILSMNKINAQRGTEDAVTEPLKIILYINGLEVMFRNSQFKSSPQRSHELLRDTLLKLRVMGNDENENASIRTLLEFPKEQLLDYYLKKNNNTRTSSVRSKRRRIKNGDSLAEYIWKYYADSLFE psy3_yeast Platinum sensitivity protein 3 PSY3 L8039.17 YLR376C protein protein yeast Saccharomyces cerevisiae Baker's yeast MEVLKNIRIYPLSNFITSTKNYINLPNELRNLISEEQESKLGFLHIIESDFKPSVALQKLVNCTTGDEKILIIDIVSIWSQQKQRQHGAIYMNSLSCINITGLIVFLELLYDSPMDALRRCQVDNFNFQLRGIVIDNLSFLNFESDKNYDVINLSKFEKLFKILRKLREFLGCWIITKSFPTDFYNGIENTLVDKWSIKRKSGVTLYPTKLPDSYMKGMDLIIYREVVDGRPQYRRIAALEE B652FD8113EB4C12 shu1_yeast Suppressor of HU sensitivity involved in recombination protein 1 SHU1 YHL006C protein protein yeast Saccharomyces cerevisiae Baker's yeast MQFEERLQQLVESDWSLDQSSPNVLVIVLGDTARKYVELGGLKEHVTTNTVAGHVASRERVSVVFLGRVKYLYMYLTRMQAQANGPQYSNVLVYGLWDLTATQDGPQQLRLLSLVLRQCLSLPSKVEFYPEPPSSSVPARLLRFWDHIIR 8B17700BDAA2367F shu2_yeast Suppressor of hydroxyurea sensitivity protein 2 D4436 YDR078C SHU2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKDVIEYSKLFAKLVNTNDDTKLDDTIASFLYYMFPRELFIRAISLLESSDMFIYILDRVHNKEGNEHTSLIDVLVDEFYKGSSNSLLEYRLIVKDTNDGAPPILVDIAHWFCSCEEFCKYFHEALEKTDEKEELHDVLINEVDDHLQFSDDRFAQLDPHSLSKQWYFKFDKVCCSHLLAFSILLRSSINVLKFFTVNSNKVFVIAIDNIDEWLNLHINIVE A02B8EBF38FC4423 csm2-psy3-1 1296419 csm2_yeast CSM2 1296421 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified psy3_yeast PSY3 1296422 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false mint f1 t1 csm2-psy3-2 1296420 shu1_yeast Shu 1 1296423 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified yd078_yeast Shu 2 1296424 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified csm2_yeast CSM2 1296421 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified psy3_yeast PSY3 1296422 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified physical association physical association false false false f4 mint