IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wu-2012a-1 Telomeric 3' Overhangs Derive from Resection by Exo1 and Apollo and Fill-In by POT1b-Associated CST. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wu P., Takai H., de Lange T. Interactions with multiple different baits with the same tag not included as it is difficult to tell what is binding to what. delange@mail.rockefeller.edu Cell (0092-8674) 2012 Only protein-protein interactions imex curation h7bx60_mouse Protection of telomeres protein 1 Pot1b protein protein mouse Mus musculus Mouse MSSAPVAPSTYTPLNLLKEGTVVNVCGVVKFFKPPYLSKGTDYCSVVTIVDQTNVKLTCMLFSRDYDTLPSVYKVGDIVCFQGLKIQAYKNELQAISKFGFASLTFDGTLGAPIILRTLSKRFNFTAQDYSMVEALRTWASTHISASSNLVQLSDAQPMQYYDLTCQLLGKAQVDGVSFLLKVWDGTRTKIPSWRVCIQDVAFEGDLSHILQLQNLVVDIVVYDNHVQVAKSLKIGSFLRIYSLHTKLQPINSESTTSLVRLEFHLHGGTSYGRGIRVLPESNYDVDQLKKALESVDLEAIQTSDDTYQSDNVENCLTSSSSESDLVSLYEVERCQPLCATTLTGYHHLEKTSLCDILKQRAPRQYRIRAKLRSYKPRRLPQSVKLFCPKCHLLQEIPSEENVDKILQDATATAPDCKLQDTPLYDSEVWTTEGQGGRQVAVHFVKNDGVLPHSSECLVLIEGGRLCEISRLSSMFHSVIPVRSGPEDLELVDLAAPFLIRGKVCHYGCKQCSNLKTIQNLSIIPNKRLWIPSSVAEVLGIVPLQYVFVMTFMFDDGTGVLDVYLKDSEKFFQIPASEVLTDDDLQRNLEQIMNVICPPGIKIDAHPWLECLIKSYNVTSGTEHQICYQIFDTMIAEDII stn1_mouse CST complex subunit STN1 Stn1 Alpha-accessory factor of 44 kDa Obfc1 Oligonucleotide/oligosaccharide-binding fold-containing protein 1 Suppressor of cdc thirteen homolog protein protein mouse Mus musculus Mouse MPQPCLLMECESSPREEEIPPLFWGLDPVFLAFAKLYIKDILEMKESQQVPGTYFYNGHPIRRVDIMGAVISVKERETFYSYGVDDATGVINCVCWKKLSNAESSSDPAILSTARELSMTSQLKKLQETIEQKTRIGIGDIIRVRGSVRMFREEREICANIYYKVDDPVWNMQIARMLELPKLYQKVYDQPFRNPALQEEEALNNKDNLDLAGLTSLLSEKIKEFLQEKKMQSFYQQELETVESLQSLASRPVTHSTGSDQVELKDSGTSGVAQRVFKNALQLLQEKGLVFQRDSGSDKLYYVTTKDKDLQQKIYHIIKEDCQKPNHMEKGCHLLHILNCVHLNLRWDLSKAVLQRVLELLEDQSDIVSTADHYYAAF ctc1_mouse CST complex subunit CTC1 Ctc1 Alpha-accessory factor of 132 kDa Conserved telomere maintenance component 1 protein protein mouse Mus musculus Mouse MAACRAQPPTSEQAWLEAAQTFIQETLCPAGKEVDKELTRSVIACVKETWLSQGENQDLTLPFSYSFVSVQSLKTHQRLPCCSHLSWSQSAYQAWTRGGRPGDGVLPREQLILLGTLVDLLGDSEQECRSGSLYVRDNTGTLDCELIDLDLSWLGHLFLFPSWSYLPSAKRNSLGEGHLELWGTPVPVFPLTVSPGPLIPIPVLYPEKASHLLRYRKKSSIKEINLAGKLVHLSALIITQNKRYFIMTLGELAQAGSQVSIIVQIPAQMVWHRVLRPGRAYVLTKLQVTKTRIHLSCIWTTIPSSTLKPLRPGYVQELELDLEFSKADLKPPPQPTSSKDSRGQEGLVRASKVLHYLGTVTAVLHESAGLYILDGQLILCLAYQKIHGLRRVIRPGVCLELRDVHLLQAVGGATTKPVLALCLHGTVRLQGFSCLKPLTLPSSKVYGASLYEQLVWKCQLGLPLYLWAAKTLEDLIYKLCPHVLRCHQFLKQPSPGKPSLGLQLLAPSWDVLIPPGSPMRHAYSEILEEPHNCPLQKYTPLQTPYSFPTMLALAEEGQHRAWATFDPKAMLPLPEASHLTSCQLNRHLAWSWVCLPSCVFQPAQVLLGVLVASSRKGCLELRDLRGSLPCIPLTESSQPLIDPNLVGCLVRVEKFQLVVEREVRSSFPSWEEMGMARFIQKKQARVYVQFYLADALILPVPRPTFGSEPSQTASSCPEGPHLGQSRLFLLSHKEALMKRNFCLLPGDSSQPAKPTLSFHVSGTWLCGTQRKEGSGWSPPESLAVESKDQKVFLIFLGSSVRWFPFLYPNQVYRLVASGPSQTPVFETEGSAGTSRRPLELADCGSCLTVQEEWTLELGSSQDIPNVLEVPRTLPESSLAQLLGDNSPDSLVSFSAEILSRILCEPPLALRRMKPGNAGAIKTGVKLTVALEMDDCEYPPHLDIYIEDPQLPPQIGLLPGARVHFSQLEKRISRSNIVYCCFRSSTSVQVLSFPPETKASAPLPHIYLAELLQGDRPPFQATTSCHIVYVLSLQILWVCAHCTSICPQGKCSRRDPSCPSQRAVSQANIRLLVEDGTAEATVICRNHLVARALGLSPSEWSSILEHARGPGRVALQFTGLGGQTESASKTHEPLTLLLRTLCTSPFVLRPVKLSFALERRPTDISPREPSRLQQFQCGELPLLTRVNPRLRLVCLSLQEPELPNPPQASAASS ten1l_mouse CST complex subunit TEN1 Ten1 Protein telomeric pathways with STN1 homolog Telomere length regulation protein TEN1 homolog protein protein mouse Mus musculus Mouse MLPKPGVYYFPWEVSDGHVPEGSTLRTFGRLYLYDMARSLMTLAAPQKPDQCQLLVCTNLVEPFEAHVNFLYMVLGDLERMEGGAFVVRARLLTCVEGMDLSLLEKAILEQRRHLQKRQQPIGDASTLQTPTPAPQSIPSDSLSLEPENRGQQVPLPQTLD acd_mouse Adrenocortical dysplasia protein Acd protein protein mouse Mus musculus Mouse MSDSGLLALQPWIRELILGSETLSSPRTGQLLKVLQDSETPGPSSAPDTPDTGAVLLVSDGTHSVRCVVTRNAIDTSDWEEKELGFRGTEGRLLLLQACGLRVQVAQDHAPAEFYLQVDRFNLLPTEQPRIQVTGCNQDSDVQRKLNECLEDHLSESASSSAGLTLSQLLDEVREDQDHRGALVCLAKSCLVLKGPCTTTPLTDWITSGSQALGKAVFTVSGSLLHIPEGEEQILSSTGSSQKARGTSASPSHMPLEESGASVSLLSALATSDPGQMDSSQSPPAVGSTSPRAQAPTSPPCNSTPSSLLLNCSPSLSPLHPAPRSHQSCETRAQAPKLEFQCSFKKRQLLPRTSAQELCSVWEPPERHRDTSAFQYKYETPSASLHTQVQTARLSPQLVAWALNIVMESESELTQV ctc1-obfc1-1 1310643 n/a 1310644 unspecified role unspecified role prey prey H7BX60:p.[Leu329Pro;Val332Glu;Asp638_Ile640delinsAsnValVal] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false H7BX60:p.[Leu329Pro;Val332Glu] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false H7BX60:p.Asp638_Ile640delinsAsnValVal mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1310645 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1310646 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5A, Supp. Fig. 5D pot1b-ctc1 1310643 n/a 1310645 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1310644 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1310646 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Figs. 5A, 5C Flag-tagged Ctc1 and Ten1 also transfected into cells but not shown in complex by western blot pot1b-ctc1-2 1310643 n/a 1310647 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1310644 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1310646 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1310645 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 5B Flag-tagged Ctc1 and Ten1 also transfected into cells but not shown in complex by western blot pot1b-ctc1-4 1310643 n/a 1310644 unspecified role unspecified role bait bait H7BX60:p.[Leu329Pro;Val332Glu;Asp638_Ile640delinsAsnValVal] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false H7BX60:p.Asp638_Ile640delinsAsnValVal mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false H7BX60:p.[Leu329Pro;Val332Glu] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a 1310646 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1310645 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1310647 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5A, Supp. Fig. 6E pot1b-ctc1-5 1310643 n/a 1310646 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1310644 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false H7BX60:p.[Leu329Pro;Val332Glu;Asp638_Ile640delinsAsnValVal] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false H7BX60:p.Asp638_Ile640delinsAsnValVal mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false H7BX60:p.[Leu329Pro;Val332Glu] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a 1310645 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 5E, 5F, 5H, 5I pot1b-acd-1 1310643 n/a 1310644 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1310648 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. 6C