Molecular Connections Molecular Connections Pvt. Ltd. 2/2, Kariappa Road, Basavanagudi, Bangalore -560 004 www.molecularconnections.com www.molecularconnections.com su-2012a-1 Lyn is involved in CD24-induced ERK1/2 activation in colorectal cancer. human-sw480 Human SW480 adenocarcinoma cell line sw480 SW480- human primary colorectal adenocarcinoma cell line There is a G -> A mutation in codon 273 of the p53 gene resulting in an Arg -> His substitution and a C -> T mutation in codon 309 resulting in a Pro -> Ser substitution. http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CCL-228&Template=cellBiology anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Su N., Peng L., Xia B., Zhao Y., Xu A., Wang J., Wang X., Jiang B. Cancer - Interactions investigated in the context of cancer The ERK1/2 -Lyn (reverse IP) cannot be added due to lack of antibody specificity. Source of protein CD24 taken from PMID:19860845. sunwingwxy@163.com sunwingwxy@163.com,helen2003517@163.com Mol. Cancer 2012 Only protein-protein interactions imex curation su-2012a-2 Lyn is involved in CD24-induced ERK1/2 activation in colorectal cancer. human-sw620 Human caucasian colon adenocarcinoma SW620 cells sw620 Human caucasian colon adenocarcinoma SW620 cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Su N., Peng L., Xia B., Zhao Y., Xu A., Wang J., Wang X., Jiang B. Cancer - Interactions investigated in the context of cancer The ERK1/2 -Lyn (reverse IP) cannot be added due to lack of antibody specificity. Source of protein CD24 taken from PMID:19860845. sunwingwxy@163.com sunwingwxy@163.com,helen2003517@163.com Mol. Cancer 2012 Only protein-protein interactions imex curation cd24_human Signal transducer CD24 CD24 CD24A Small cell lung carcinoma cluster 4 antigen protein protein human Homo sapiens Human MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS lyn_human Tyrosine-protein kinase Lyn JTK8 Lck/Yes-related novel protein tyrosine kinase V-yes-1 Yamaguchi sarcoma viral related oncogene homolog p53Lyn p56Lyn LYN protein protein human Homo sapiens Human MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVIKHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQADGLCRRLEKACISPKPQKPWDKDAWEIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHDKLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCFTIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCWKEKAEERPTFDYLQSVLDDFYTATEGQYQQQP mk03_human Mitogen-activated protein kinase 3 ERT2 MAP kinase isoform p44 Microtubule-associated protein 2 kinase Extracellular signal-regulated kinase 1 Insulin-stimulated MAP2 kinase p44-ERK1 MAPK3 ERK1 PRKM3 protein protein human Homo sapiens Human MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP mk01_human Mitogen-activated protein kinase 1 MAPK1 ERK2 PRKM1 Extracellular signal-regulated kinase 2 Mitogen-activated protein kinase 2 MAP kinase isoform p42 ERT1 PRKM2 protein protein human Homo sapiens Human MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS lyn-mapk1-4 1312252 n/a 1312254 unspecified role unspecified role ancillary ancillary n/a 1312255 unspecified role unspecified role bait bait n/a 1312256 unspecified role unspecified role prey prey n/a 1312257 unspecified role unspecified role prey prey association association false false false fig. 5a Lyn interacted with ERK1/2 directly or indirectly in a CD24-dependent manner. lyn-cd24-4 1312252 n/a 1312255 unspecified role unspecified role bait bait n/a 1312254 unspecified role unspecified role prey prey physical association physical association false false false fig. 1b cd24-lyn 1312252 n/a 1312255 unspecified role unspecified role prey prey n/a 1312254 unspecified role unspecified role bait bait physical association physical association false false false fig. 1b lyn-mapk1-3 1312253 n/a 1312256 unspecified role unspecified role prey prey n/a 1312255 unspecified role unspecified role bait bait n/a 1312257 unspecified role unspecified role prey prey n/a 1312254 unspecified role unspecified role ancillary ancillary association association false false false fig.5b Lyn interacted with ERK1/2 directly or indirectly in a CD24-dependent manner. lyn-cd24-7 1312253 n/a 1312255 unspecified role unspecified role bait bait n/a 1312254 unspecified role unspecified role prey prey physical association physical association false false false fig. 1c lyn-cd24-2 1312253 n/a 1312254 unspecified role unspecified role bait bait n/a 1312255 unspecified role unspecified role prey prey physical association physical association false false false fig. 1c