MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint hosono-2012a-1 The murine Gcap14 gene encodes a novel microtubule binding and bundling protein. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Hosono H., Yamaguchi N., Oshima K., Matsuda T., Nadano D. FEBS Lett. (0014-5793) 2012 q3uhi0-3 Protein GCAP14 protein protein mouse Mus musculus Mouse MNSIDILNNLESCDLEDDDLMLDVDLPEDAPLENVECDNMNRFDRTDRNVRQSQDGFWKRPPQRWSGQDHYHLSHPGHYHHHGQSDLSRGSPYRESPLGHFESYGGTPFFQAQKMFVDVPDNTVILDEMTLRHMVQDCTAVKTQLLKLKRLLHQHDGSGSLHDVQLSLPSSPEPEDGDQIYKNEDLLNEITQLKEEIKKKDEKIQLLEQQLATRCNCQQKSKEEKCTYADKYTQTPWRRIPPQVLQPSSSLPRSTDHAQGKLIKPQRTEAHSDYTVQGVCPGGAHPDGSCTHGLQQDNSRGLQERPSSSSPQLTVDVVKYIPSETDLSMTLDAQEPHHLAEKKPSDLQFVTPPPQTPSQSSTVDQTKRGGRNQCPQPKSLQLLKPSNLSSLTPPPDSDSSPSRTSTCKKAPGITPCHSKHQPTSNQNNPANHLNLKTSKLRPPSGSFKQKQISNPQVEPQNFQAKTSIPRPLARPKELHAPHSGLHSGDCVASNRYSRLPKPKIH mint homomint The sequence has been withdrawn from uniprot. q3uhi0_3-q3uhi0_3 1283637 q3uhi0-3 Gcap14 1283638 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q3uhi0-3 Gcap14 1283638 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f4b homomint mint q3uhi0_3-q3uhi0_3-1 1283637 q3uhi0-3 Gcap14 1283638 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q3uhi0-3 Gcap14 1283638 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f4b homomint mint