mpidb The Microbial Protein Interaction Database liu-2012c-1 Novel L-cysteine-dependent maleylpyruvate isomerase in the gentisate pathway of Paenibacillus sp. strain NyZ101. ecolx Escherichia coli comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Liu T.T., Zhou N.Y. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation h6tg59_9bacl bagL protein protein paenibacillus sp. ny Paenibacillus sp. NyZ101 MSIQEAIRSIHETIDDIVRVSKGLSEDVIRWKPAEDKWSIIEVLCHVEEATPYWLNEIQALVQSPGIEWGRGLQHEGRLAAVAAAPGRSTDEVLQAIESSKAQVQAVLGTLNEENVTAESPSRNPRFGTKSLQFVVDHLLVEHLITHLKQINRNIGQYQEAH bagl-bagl-1 1339812 not-defined-609589841 1339813 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-1304916506 1339813 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2