IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ price-2012-3 A role for the vesicle-associated tubulin binding protein ARL6 (BBS3) in flagellum extension in Trypanosoma brucei. in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Price H.P., Hodgkinson M.R., Wright M.H., Tate E.W., Smith B.A., Carrington M., Stark M., Smith D.F. Diabetes - Interactions investigated in the context of Diabetes T. brucei brucei BSF strain Lister 427 and T. brucei brucei procyclic strain 449. helen.price@york.ac.uk Biochim. Biophys. Acta (0006-3002) 2012 Only protein-protein interactions imex curation price-2012-1 A role for the vesicle-associated tubulin binding protein ARL6 (BBS3) in flagellum extension in Trypanosoma brucei. tryb2 Trypanosoma brucei brucei (strain 927/4 GUTat10.1) confocal microscopy confocal microscopy immunostaining immunostaining Price H.P., Hodgkinson M.R., Wright M.H., Tate E.W., Smith B.A., Carrington M., Stark M., Smith D.F. Diabetes - Interactions investigated in the context of Diabetes T. brucei brucei BSF strain Lister 427 and T. brucei brucei procyclic strain 449. helen.price@york.ac.uk Biochim. Biophys. Acta (0006-3002) 2012 Only protein-protein interactions imex curation q57uh8_tryb2 Tb927.8.5060 protein protein tryb2 Trypanosoma brucei brucei (strain 927/4 GUTat10.1) MGQSKTKLQVVMCGLDNSGKTTIINQVKPAQSSSKHITATVGYNVETFEKGRVAFTVFDMGGAKKFRGLWETYYDNIDAVIFVVDSSDHLRLCVVKSEIQAMLKHEDIRRELPGGGRVPFLFFANKMDAAGAKTAAELVEILDLTTLMGDHPFVIFASNALKGTGVHEGFSWLQETASRQSGKAGTKRG guanidinium hydrochloride guanidinium (hydro)chloride small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) magnesium(2+) Magnesium(2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) gtp guanosine triphosphate - GTP 5'-GTP GTP Guanosine 5'-triphosphate guanosine 5'-triphosphoric acid guanosine triphosphate GUANOSINE-5'-TRIPHOSPHATE H4gtp guanosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 gdp guanosine 5-diphosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) q4gyy5_tryb2 Tubulin alpha chain TB927.1.2340 TB927.1.2360 TB927.1.2380 TB927.1.2400 protein protein tryb2 Trypanosoma brucei brucei (strain 927/4 GUTat10.1) MREAICIHIGQAGCQVGNACWELFCLEHGIQPDGAMPSDKTIGVEDDAFNTFFSETGAGKHVPRAVFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNYARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVYHAVGGGTGSGLGALLLERLSVDYGKKSKLGYTVYPSPQVSTAVVEPYNSVLSTHSLLEHTDVAAMLDNEAIYDLTRRNLDIERPTYTNLNRLIGQVVSSLTASLRFDGALNVDLTEFQTNLVPYPRIHFVLTSYAPVISAEKAYHEQLSVSEISNAVFEPASMMTKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAESADMDGEEDVEEY q38du9_tryb2 BBS1 domain-containing protein Tb09.211.2080 protein protein tryb2 Trypanosoma brucei brucei (strain 927/4 GUTat10.1) MPFFSLDRLFIVMRREQLGRNHAEKNQQKEFWIFAFRDRLAGLQAFSNCVEVADIYGNGDNKLIVADASKTLKIYDGTSLSEEIRLSAVPSAITVVFAEAGDDQHLPVIAVSCGPDVFMYRKMKPLYRFTVPCVELDEVDVSVWEQLRNGNISAAEACTRLKERRMAGVKLSTRSADLLALQGTEERERFVQYHKTKPLSEQDVVTCISSLSLDRVEDGGRSCLVIGTETRHIYVLAEKFTGVHHRVRLPGVPTCIVSLGSFRVDYRIVVACRDGCVYTVKNGELADYSIHSDGAIVQIALCENLVAVATTQNTLSYYKLKGKCEMRVFLPSPITGIATLLDSASGKARGVIVALKSGMVRVYVGKTLLHEAQVYGRVTAMKFGRYGREDAALILVMQNGTLVVEMLHRNASFECKRNQDSGPPGEQDVPIPVPPLTNVFVAQAERERAYSIDMHRLFQRDLTMLRLTTAKAYLSLLSDTHKPAVSPKKTAAPAVPMLGNSVRMITSVQGLGPVFRIRAKIQNISKGVLRDLSLVVSCSCTTYKISNSILCVPFLLPSTVSTCEVLVERLDDNAIDEGICLSVTSSHSLSTLAAVDVRLPDAGFIEDNS guanidinium_h-q57uh8 1295965 n/a 1295967 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1295968 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig 5A denaturation/ loss of folding -causing an increase in tryptophan fluorescence and a red shift of the emission maximum from 350 nm to 356 nm. gtp-magnesium 1295965 n/a 1295969 unspecified role unspecified role neutral component neutral component n/a 1295970 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1295967 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig 5B gdp-magnesium 1295965 n/a 1295969 unspecified role unspecified role neutral component neutral component n/a 1295971 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1295967 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig 5B mant_gtp-magnesium_2 1295965 n/a 1295967 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1295970 unspecified role unspecified role neutral component neutral component mant-gtp fluorophore fluorophore undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1295969 unspecified role unspecified role neutral component neutral component physical association physical association false false false 1295965 1295965 1295965 Fig 5D/F/H The κdiss for N-methylanthranil acid (mant)GTP was found to be 0.0047 s-1 when displaced with unlabelled GDP and 0.0041 s− 1 when displaced with unlabelled GTP. mant_gdp-magnesium_2_ 1295965 n/a 1295969 unspecified role unspecified role neutral component neutral component n/a 1295967 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1295971 unspecified role unspecified role neutral component neutral component mant_gdp fluorophore fluorophore undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false 1295965 1295965 1295965 Fig 5C/E/G The κdiss for N-methylanthranil acid labelled (mant)GDP was found to be 0.0076 s− 1 when displaced with unlabelled GDP and 0.0093 s− 1 when displaced with unlabelled GTP. q4gyy5-q57uh8 1295966 n/a 1295972 unspecified role unspecified role neutral component neutral component n/a 1295967 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig 1A q4gyy5-q57uh8-1 1295966 n/a 1295967 unspecified role unspecified role neutral component neutral component n/a 1295973 unspecified role unspecified role neutral component neutral component n_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Fig 6B ARL6 co-localises with the MYCBBS1 protein at the posterior end of the parasite.