MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint liu-2012f-1 Drosophila Bicoid is a substrate of sumoylation and its activator function is subject to inhibition by this post-translational modification. drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Liu J., Ma J. FEBS Lett. (0014-5793) 2012 bcd_drome Homeotic protein bicoid bcd CG1034 PRD-4 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAQPPPDQNFYHHPLPHTHTHPHPHSHPHPHSHPHPHHQHPQLQLPPQFRNPFDLLFDERTGAINYNYIRPYLPNQMPKPDVFPSEELPDSLVMRRPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQSYEGMPLSPGMKQSDGDPPSLQTLSLGGGATPNALTPSPTPSTPTAHMTEHYSESFNAYYNYNGGHNHAQANRHMHMQYPSGGGPGPGSTNVNGGQFFQQQQVHNHQQQLHHQGNHVPHQMQQQQQQAQQQQYHHFDFQQKQASACRVLVKDEPEADYNFNSSYYMRSGMSGATASASAVARGAASPGSEVYEPLTPKNDESPSLCGIGIGGPCAIAVGETEAADDMDDGTSKKTTLQILEPLKGLDKSCDDGSSDDMSTGIRALAGTGNRGAAFAKFGKPSPPQGPQPPLGMGGVAMGESNQYQCTMDTIMQAYNPHRNAAGNSQFAYCFN o97102_drome Small ubiquitin-related modifier smt3 Smt3 DmSUMO-1 Dm0342 DmSmt3 Dmel\CG4494 Dmsmt3 SMT3 SUMO Sumo anon-EST:Posey240 dSmt3 dsmt3 l(2)04493 l(2)SH0182 l(2)SH2 0182 CG4494 sumo Dmel_CG4494 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSDEKKGGETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRFRFDGQPINENDTPTSLEMEEGDTIEVYQQQTGGAP bcd-smt3 1290327 bcd_drome Bicoid 1290328 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false o97102_drome SUMO 1290329 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f1f mint smt3-bcd 1290327 bcd_drome Bicoid 1290328 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false o97102_drome SUMO 1290329 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mint f1e f2 smt3-bcd-1 1290327 bcd_drome Bicoid 1290328 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false o97102_drome SUMO 1290329 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mint f1e f2