mpidb The Microbial Protein Interaction Database dos-2012-2 DivIVA-mediated polar localization of ComN, a posttranscriptional regulator of Bacillus subtilis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined dos Santos V.T., Bisson-Filho A.W., Gueiros-Filho F.J. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation dos-2012-1 DivIVA-mediated polar localization of ComN, a posttranscriptional regulator of Bacillus subtilis. baciu Bacillus subtilis fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence dos Santos V.T., Bisson-Filho A.W., Gueiros-Filho F.J. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation dos-2012-3 DivIVA-mediated polar localization of ComN, a posttranscriptional regulator of Bacillus subtilis. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western dos Santos V.T., Bisson-Filho A.W., Gueiros-Filho F.J. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation comn_bacsu Post-transcriptional regulator ComN comN yrzD BSU27660 protein protein bacsu Bacillus subtilis MEKHPADLYKDHVRPFLYSKLEEFKILGYDDVELESLWSYLTDKKWKKKTELSIYELASDILSVKIGEFMNYATVESFKTSNWLGSEEGQEALEELLR div4a_bacsu Septum site-determining protein DivIVA ylmJ Cell division initiation protein DivIVA Minicell-associated protein DivIVA BSU15420 divIVA protein protein bacsu Bacillus subtilis MPLTPNDIHNKTFTKSFRGYDEDEVNEFLAQVRKDYEIVLRKKTELEAKVNELDERIGHFANIEETLNKSILVAQEAAEDVKRNSQKEAKLIVREAEKNADRIINESLSKSRKIAMEIEELKKQSKVFRTRFQMLIEAQLDLLKNDDWDHLLEYEVDAVFEEKE comn-comn 1339737 not-defined-593203720 1339740 unspecified role unspecified role bait bait not-defined-1043355000 1339740 unspecified role unspecified role prey prey physical association physical association false false false Supplemental figure 1 diviva-comn 1339737 not-defined-1520373008 1339741 unspecified role unspecified role bait bait not-defined-1137668320 1339740 unspecified role unspecified role prey prey physical association physical association false false false figure 4A comn-diviva-1 1339737 not-defined-253888880 1339741 unspecified role unspecified role prey prey not-defined-1928335717 1339740 unspecified role unspecified role bait bait physical association physical association false false false figure 4A comn-diviva-2 1339738 not-defined-176684356 1339741 unspecified role unspecified role neutral component neutral component p71021-- P71021-- gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-2138367566 1339740 unspecified role unspecified role neutral component neutral component region O32049-- mcherry mcherry fluorescent protein tag mcherry undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false figure 2B diviva-comn-1 1339739 not-defined-2038947958 1339741 unspecified role unspecified role bait bait p71021-- P71021-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-479856236 1339740 unspecified role unspecified role prey prey o32049-- O32049-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 4B